KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1739.14
Entry
SPCC1739.14       CDS       T00076                                 

Gene name
npp106
Definition
(RefSeq) nucleoporin Npp106
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Nic96 RelA_SpoT Flg_bb_rod
Other DBs
NCBI-GeneID: 2539077
NCBI-ProteinID: NP_588422
PomBase: SPCC1739.14
UniProt: O14310
Position
III:join(2059929..2060152,2060315..2062892)
AA seq 933 aa
MESKEAKEKGVNTSDSKGSQIESSISDLREKSQHLFGVLLEPQVPVIQYGLNQLEEKARN
LESKVLLTRDGDTKAHYLLAESGMNAEQTRQKIYSIHIHSPWDQLELDKKSLYEQPHTKL
YNGQNVVASIENGYQSNVYEFQLRLMKNNGIAWENTKTEFMEDVGKLLHSKDNSGLGTSI
SMSLRPNLARPLLTASSVKSQSVRSLREVGSNLPIPTGSLTKIDGLNNQLSNDLTRSQTT
NIFGFAEKASSFAAAVHKLNEARIRNQACHVWSLFASVSQMVNTEVIQLFDAWSLLAHMI
DETRYGMGDFEARHLALDSSSAALAVEKNCIEGSLKYLENQFLSLIDLHLSDAGHITTVN
SVEKVIAYSKLRFYKNGSWIKSTVSVVNDVPLWVVLFYLMRSGQLDAALQFVNTYSDDFE
KLGRSFPLYFYSYAKNPSLPLPKQLRDRLQAEYGQLMKYAPEDPFKHAIYKLLGNCEPHR
VSLPEVCVTSEDYMWIQLMFCRVNQNDVIDSNGGQSTNSLFNLYQLEKKIVAFGPRYFNP
KNNTPTNYFLALLMCGEFERAISFLHTNYPVEATHFAVAMAYYGLLRTKNYEKNENILIY
EADDVKINFPQLIIAYLKHLEYVDAAVYLDYIACIPLVPAYQACSINLTKILLLQSHEFS
KFLGDIKPDTERTTGLLDLYLRLIPFDHDSLQKLYLEGAREADDDGRFGDSIILYHLLGD
YDTVIGVAIKNLSQSIVSRGLWSIDSKESKNMHISSNVVASEAPDALAANLLAMYESNPK
KSAKVSATNKKALKVLLKVVKVQKLYGQEKWDEVLQLIEHLDLLPINEVQAEFEPNEQIP
PISARLRRRAFEFSTFQDEVLSVIPSLMYISMSSIKALYRTISKLPVVNEESKKKLQRLQ
FKGSMLVMFSTMIESRLSPQILEYLQAEQLTLL
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggaatccaaggaagccaaagagaaaggggtaaatacttctgactctaagggatctcag
atagaaagttctatatcggatttacgtgaaaaatcacaacatttgtttggtgtcctccta
gaacctcaagtgccagttattcaatatggattaaatcaattagaagagaaggctcgaaat
ttagagtcaaaagttttattgacgcgtgacggtgatacgaaagctcattacttgctggct
gaaagtggtatgaacgctgagcaaacacgccaaaagatttattccattcatattcattct
ccttgggatcaattggagcttgacaagaagtctttgtatgagcaacctcatacgaaacta
tacaatggacaaaatgtggttgctagcatagagaacggctatcaaagcaatgtttacgag
ttccaattacgactaatgaaaaataatggcatagcgtgggaaaatacaaaaacggaattt
atggaagatgtcggtaaattgcttcactccaaggataattccggtttaggtacttcaatc
agcatgtcgcttagaccaaatttggctaggccgttattgacagcttcatccgttaaatca
cagagtgttcgttcgttacgagaagtcggttcaaacctaccaattcctacagggtccttg
accaagatagacggccttaataatcaactttctaatgacttgactagatcacagacgacg
aacatttttggttttgccgaaaaagctagttcatttgcagcagctgttcacaaattaaat
gaggcacggattaggaatcaagcctgccatgtttggtctttgtttgcatcggttagtcag
atggtaaataccgaagttattcaacttttcgatgcatggtctttgttggcccatatgatt
gatgaaacccggtatggtatgggtgattttgaagctagacatttggctctggattctagc
tctgccgcgcttgccgtagagaaaaactgcatagaagggtctttaaagtatttagaaaac
cagtttttatcattgattgatctgcacctctcggatgctggtcatattactactgtcaat
tctgtggagaaagtgatcgcttacagtaagcttcgattctacaaaaacgggtcatggatt
aagtctaccgtatcagtggtcaatgatgttcctttgtgggttgtcttgttctatctaatg
aggtcagggcagttagatgctgccttgcaatttgtgaacacctattccgacgattttgaa
aaacttggtagatcgttcccactttatttctactcctatgccaaaaacccttctcttccg
ttgccaaaacaattgcgtgatcgcttacaggctgagtatggtcaactaatgaaatatgct
cctgaagatccttttaaacacgcaatatataaattattagggaactgtgaaccacatcgc
gtatcccttcctgaagtttgtgtaacgtccgaggattatatgtggattcaattaatgttt
tgccgtgtaaatcagaacgacgtgattgattccaacggtgggcaatccacaaattctctc
tttaacttatatcagctagaaaagaaaattgtcgcttttggtcccaggtacttcaatcca
aagaataatacaccaaccaactattttctcgctcttttaatgtgtggtgaatttgaacgg
gcaataagctttctgcacacaaattatccagtggaggctactcattttgctgtagcaatg
gcttactacggtctcttacgtactaaaaattacgaaaaaaatgaaaatatcttgatatat
gaagctgacgacgttaaaattaactttccacaattgatcattgcttacctgaaacatttg
gagtatgttgatgcagctgtttatttagactacatagcttgcatacctttggttcccgct
tatcaagcgtgtagtattaatttaacgaaaatacttctgcttcaatcgcatgagttttca
aagtttttgggggacatcaaaccggatactgagcgtacaaccggattgttagacttgtat
cttcgtctcattccttttgatcatgactcattacaaaagttgtatttggaaggcgctaga
gaggcagacgatgatggacggtttggggactcaatcatactataccatttgctcggggat
tacgatacagtgattggtgttgctatcaaaaaccttagtcaaagtattgtttctcgaggt
ttatggtctatcgattccaaagaaagtaaaaatatgcatatttcttctaatgttgtagct
agtgaagctccagatgccttggctgcaaatctgttagcaatgtacgaatccaatccaaag
aaaagtgcaaaagtttcagcaaccaacaaaaaggcattaaaagttctgcttaaagttgtc
aaagtacaaaaactgtatggtcaagaaaaatgggacgaagttcttcagctaattgaacat
ttggatcttttgccaatcaatgaagtgcaagctgaattcgaacccaatgaacaaattcca
ccaatttctgcacgtttacggcgtcgcgcttttgagttttccacattccaggatgaggtc
ttgagcgttattccatccttaatgtacatttccatgtcttccattaaagctttgtacaga
acaatatctaaacttcctgtagtcaatgaggaatcaaagaagaaattacaacgtttgcaa
tttaaagggtctatgttggtgatgttcagtaccatgatagaatcacggttgtctccccaa
attctagaataccttcaagctgagcaactgactcttctgtaa

DBGET integrated database retrieval system