KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1753.01cHelp
Entry
SPCC1753.01c      CDS       T00076                                 

Gene name
ssb2, rpa2, SPCC584.06c
Definition
(RefSeq) single-stranded DNA binding protein Ssb2
  KO
K10739  replication factor A2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
spo03440  Homologous recombination
Module
spo_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:spo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SPCC1753.01c (ssb2)
   03420 Nucleotide excision repair
    SPCC1753.01c (ssb2)
   03430 Mismatch repair
    SPCC1753.01c (ssb2)
   03440 Homologous recombination
    SPCC1753.01c (ssb2)
DNA replication proteins [BR:spo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    SPCC1753.01c (ssb2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     SPCC1753.01c (ssb2)
   MMR (mismatch exicision repair)
     SPCC1753.01c (ssb2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     SPCC1753.01c (ssb2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 UPF0147
Motif
Other DBs
NCBI-GeneID: 2538781
NCBI-ProteinID: NP_588227
PomBase: SPCC1753.01c
UniProt: Q92373
Position
III:complement(join(1540948..1541661,1541789..1541914))
Genome map
AA seq 279 aa AA seqDB search
MAYDAFGKPGYGPDFNSAFSPGMGGGAGFNEYDQSSQPSVDRQQGAGNKLRPVTIKQILN
ASQVHADAEFKIDGVEVGQVTFVGVLRNIHAQTTNTTYQIEDGTGMIEVRHWEHIDALSE
LATDTYVRVYGNIKIFSGKIYIASQYIRTIKDHNEVHFHFLEAIAVHLHFTQKANAVNGA
NAPGYGTSNALGYNNISSNGAANSLEQKLAEYSLTPAQMTVMQAIHSAPETNEGVHVRQL
AQSVGPGIDLTAVTDFLQQEGIIYTTIDENHFKSVLQDQ
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcttatgatgcttttggcaagccgggctatggtcccgacttcaatagcgctttttct
ccaggaatgggaggaggcgctggatttaatgaatatgatcaatcgagccagcccagcgtc
gatagacaacaaggagctggaaataaattacgtcctgttaccattaagcaaattctcaat
gcctctcaagttcacgctgatgcagaattcaagatagatggcgttgaagtcggacaggtt
acttttgtaggagttttacggaacattcacgctcaaactacaaacacaacatatcaaata
gaagatggaacaggaatgattgaagtaaggcattgggaacacattgatgcgctatctgaa
cttgctacagacacctatgttcgtgtgtatggaaacatcaaaatattttctggaaaaatt
tacattgcttctcaatacatccgtacaattaaagaccataatgaagtccattttcatttc
cttgaagcaattgctgtacacctacatttcactcagaaagcaaatgctgtgaacggagcc
aacgctccaggctacggaacttccaacgcactaggctacaataacatttcttcaaatggt
gctgccaactctctggaacaaaaactagctgaatattcactaacccccgcacaaatgacc
gttatgcaagctatccatagtgcaccagagacgaatgaaggtgttcacgttagacaactt
gctcaaagcgtgggtcccggtatagaccttacggcggttactgattttcttcaacaagaa
ggaatcatctacacaacaattgatgaaaatcattttaaaagtgttttacaagaccaataa

DBGET integrated database retrieval system