KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1795.02cHelp
Entry
SPCC1795.02c      CDS       T00076                                 

Gene name
vcx1
Definition
(RefSeq) putative CaCA proton/calcium exchanger
  KO
K07300  Ca2+:H+ antiporter
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPCC1795.02c (vcx1)
Transporters [BR:spo02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SPCC1795.02c (vcx1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Ca_ex ATP-synt_8
Motif
Other DBs
NCBI-GeneID: 2539393
NCBI-ProteinID: NP_001342722
PomBase: SPCC1795.02c
Position
III:join(995522..995886,995943..996816)
Genome map
AA seq 412 aa AA seqDB search
MIERLKIAKNRLEAMNSFNFPAQDRHERAPLLGSEYDHSMARQLSLLNVVGMTKSVLMSS
YFNLMLVFVPIGLIAGWFEWNAKSVFILNMLAIIPLASLLSFATEQLSIISGPTLGALLN
ASFGNAIELIVGVLALKRGELRIVQSSLLGSILSNLLLVFGMCLVTTGIRREITTFNITV
AQTMIAMLALSTATILIPATFHYSLPDNANSENALLHVSRGTAVIVLIVYVLLLVFQLKT
HKHVCHDPSEVEEETEPRILGLRSSIAMLAIVTVFVSLCADYLVGSIDQLVEEVNISKTF
VGLVILPVVGNAAEHVTAIVVSYRGQMDLALGVAIGSSIQIALFLAPFLVIVGWIISQPL
TLYFESLETVILFVSVFLVNYLIQDGATHWLEGVQLLALYAIVVLAFFYYPQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgattgagagattaaagattgctaagaacagacttgaagctatgaattcttttaatttt
cccgcccaggatagacatgaacgagcccctctcttgggatcagagtatgaccactctatg
gctcgtcagttgtcgcttttaaacgtggtcggcatgaccaaatctgttttgatgtctagc
tactttaacttgatgttggtatttgttccgatcggcttaattgcaggatggtttgaatgg
aacgctaaatctgttttcatacttaacatgcttgctattatcccccttgcatccttgctt
agctttgctactgaacaactctctataattagcggaccaacattgggagcattgttgaat
gctagttttggaaatgccatcgagctcattgtaggcgttcttgctttgaaaagaggagag
ctccgcatcgttcaatcgtcccttctcggatcaatattatccaacttgcttcttgttttt
ggaatgtgtctcgtaactactggtattcgtcgtgaaattaccacatttaatatcactgtt
gcacaaactatgattgcaatgcttgctttatctactgctaccatattgattcctgcgact
ttccattacagccttcccgacaacgctaatagcgaaaatgcgcttctccatgtctctcgt
ggaactgctgttattgtactcatcgtctatgttttacttttagttttccaattaaagact
cataagcatgtctgtcatgatcccagtgaagtggaagaagaaactgaacctcgaatttta
ggccttcgttcatccattgccatgcttgctatcgtcacggtttttgtttctctttgcgca
gactatttagtaggttcgatagaccaattggttgaggaagttaacatttcaaaaactttc
gttggtttggtcatccttcctgttgtaggaaatgctgccgaacatgttactgcaatcgtg
gtatcttaccgaggacaaatggatttggctttgggtgttgctattggttccagtattcag
attgctttgtttttagctcccttcttggtaatcgtcggatggatcatctcccaaccttta
acactttactttgaatcattggaaacagttattctatttgtgtctgttttcttggttaat
tacttgatacaagatggtgctactcattggcttgaaggtgttcaattacttgctttgtat
gcgattgttgttctcgcctttttctactaccctcaataa

DBGET integrated database retrieval system