KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1795.09
Entry
SPCC1795.09       CDS       T00076                                 
Symbol
yps1
Name
(RefSeq) yapsin Yps1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Asp TAXi_N
Other DBs
NCBI-GeneID: 2538927
NCBI-ProteinID: NP_588035
PomBase: SPCC1795.09
Ensembl: SPCC1795.09
UniProt: O59774
Position
III:complement(978227..980985)
AA seq 521 aa
MRIWILIFFSFIKLVSSLQYTGNGVLALDFVAKTFPNQENQLEKRDYTYSPSGITSFPLD
LQSYTYYTTTLSIGRPSISYTVAIDLDMPYTWLTYYNVMAFNPAYLGIVNSGTQWSTDEL
RYFLCKKESDSCYFGNASSSFHFVTSPSTFFIRYDDNITVAGINVQDSLSYSHYQALPDF
QFGITLKEYVPSSMLPYKGVLGLAASTEINSIDYSDSISSFSPPTFLEQLVKEDILAYPA
FSMYLDNQGNGSLLLGAVDTSKYQGQFVALKQTKLTHYAVSIYSVQFLNSTFFSNYSIIT
DAYFQTRETYIYLPAELAYSVMDNAGAYLSEGYFALNCDEIDLEAALIFQFGCNSTIKVP
ISLLVIGQVSNICLLGIRPSTDSEIVLGLLFFRNAYTFYHQSQKMIAIGQAFYNATSNLS
AIVDQHIPGALTCSQYPTSVASTQLVQTSHFTSTSLSAVNISESVVYSYTSSSSMPSSAI
PSFNISLISQNAVANAGNSFSPLSAMVIMMMSAVFLGLGII
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaggatttggattttaatatttttctccttcattaaacttgtctcttcgttacaatat
acgggaaatggtgttttagctttggacttcgttgcgaaaacttttcccaaccaggaaaat
caattagagaagcgtgactatacttattctccatctggtatcacttcatttcctttagat
ttgcagagttacacttactacactactaccctttcgatcggtcgtccgagtatttcgtac
actgtagctatagatttggacatgccgtacacatggttgacttactacaatgtaatggcg
tttaatccagcgtatcttggcatagtgaatagtggtactcagtggagtacggatgaactg
cgatactttctttgtaaaaaagaaagtgattcttgttattttgggaatgcatcttctagc
ttccattttgttacgagtccaagcactttttttatccgctatgacgataacattacagtt
gctggaattaatgttcaggactccctttcttacagtcattatcaagctttaccggacttc
caattcggcatcacattaaaggagtatgttcccagttcaatgctgccgtacaaaggcgtg
ctaggtttagctgccagtaccgaaattaattcaatagattattcggattccatttcaagt
ttttcaccaccaacctttttggaacaactagttaaagaggatatattggcataccctgct
tttagtatgtatctggataatcagggtaatggaagtttacttttgggagccgtggatacg
tcaaagtaccagggacagtttgtcgctttgaagcagactaagcttacgcattacgccgtt
tccatttactctgtgcagttcttaaactctacgttcttttctaattattctatcatcact
gatgcatactttcaaactcgtgaaacttatatttatttgcctgccgaattggcttacagt
gtgatggataatgctggtgcctacttatccgaaggctatttcgcattaaactgtgatgaa
attgatttggaagccgctctgatatttcaatttggatgtaattcaactatcaaggtaccg
atatcgttgctagtgattgggcaagtttcaaacatatgtcttttaggtattcgaccttcg
acggatagtgagattgtattaggtttgttattttttcgaaacgcctacacattttatcat
caaagtcaaaaaatgattgccattgggcaagccttttataacgcaacatccaacttgtcc
gccatcgtggatcaacacattcctggtgctctaacttgttcgcaatatcctacgagtgtg
gcatctactcaattggttcagactagtcacttcacatccacatcgttgtctgctgtgaat
atttcggaaagcgtcgtttattcctatacaagtagtagtagtatgccctcttcagctatt
ccgtccttcaacatctctttgatttctcagaatgcggttgcaaatgctggaaattcgttt
tctccgttaagtgctatggtcattatgatgatgtctgctgtatttttaggactcggtatt
atatag

DBGET integrated database retrieval system