KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1795.11
Entry
SPCC1795.11       CDS       T00076                                 

Symbol
sum3
Name
(RefSeq) ATP-dependent RNA helicase Sum3
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPCC1795.11 (sum3)
   03041 Spliceosome [BR:spo03041]
    SPCC1795.11 (sum3)
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC1795.11 (sum3)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPCC1795.11 (sum3)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     SPCC1795.11 (sum3)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     SPCC1795.11 (sum3)
Spliceosome [BR:spo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    SPCC1795.11 (sum3)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    SPCC1795.11 (sum3)
SSDB
Motif
Pfam: DEAD Helicase_C UTP25 ResIII ERCC3_RAD25_C
Other DBs
NCBI-GeneID: 2538689
NCBI-ProteinID: NP_588033
PomBase: SPCC1795.11
UniProt: O13370
Position
III:complement(974761..976671)
AA seq 636 aa
MSDNVQQQVDSVGSVTEKLQKTNISRPRKYIPPFARDKPSAGAAPAVGDDESVSSRGSSR
SQTPSEFSSNYGGRREYNRGGHYGGGEGRQNNYRGGREGGYSNGGGYRNNRGFGQWRDGQ
HVIGARNTLLERQLFGAVADGTKVSTGINFEKYDDIPVEVSGGDIEPVNEFTSPPLNSHL
LQNIKLSGYTQPTPVQKNSIPIVTSGRDLMACAQTGSGKTAGFLFPILSLAFDKGPAAVP
VDQDAGMGYRPRKAYPTTLILAPTRELVCQIHEESRKFCYRSWVRPCAVYGGADIRAQIR
QIDQGCDLLSATPGRLVDLIDRGRISLANIKFLVLDEADRMLDMGFEPQIRHIVEGADMT
SVEERQTLMFSATFPRDIQLLARDFLKDYVFLSVGRVGSTSENITQKVVHVEDSEKRSYL
LDILHTLPPEGLTLIFVETKRMADTLTDYLLNSNFPATSIHGDRTQRERERALELFRSGR
TSIMVATAVASRGLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGQAVAFFNRNNKG
IAKELIELLQEANQECPSFLIAMARESSFGGNGRGGRYSGRGGRGGNAYGARDFRRPTNS
SSGYSSGPSYSGYGGFESRTPHHGNTYNSGSAQSWW
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgagcgacaatgtacagcaacaagtagattcagttggttctgtgactgaaaaattgcaa
aaaacaaacatcagcagacctaggaagtatattcctccttttgctagggataagccaagc
gctggcgcagctccagctgttggcgacgatgagtctgtctcatctcgtggctcttctagg
tctcaaactcctagtgagttttcctctaactatggaggtcgccgtgaatacaatcgtggc
ggtcattatggtggtggcgagggccgccaaaataattaccgtggcggtcgtgaaggtggt
tacagcaacggcggtggttatcgtaacaaccgtggatttggccaatggagagatggtcaa
cacgttatcggagcccgtaacactcttttggagcgtcaattatttggtgccgttgctgat
ggtaccaaagtttcaactggtattaacttcgaaaagtatgatgacatccctgttgaagtt
tccggtggagatatcgagcctgttaatgagttcacttctcctcctttgaactctcatctt
cttcaaaacattaaactctctggctacactcagcccaccccagttcaaaagaactccatt
cctattgtcacatccggacgtgatttgatggcctgtgcccaaaccggttccggtaagact
gctggtttcttattccctattctttctcttgctttcgataaaggacctgccgctgttcct
gttgatcaggatgccggtatgggttatcgtcctcgcaaagcctatcctaccacccttatt
ttggctcccactcgtgaattagtttgtcaaattcatgaggaatctcgtaaattctgttac
cgttcttgggtgcgtccctgtgctgtttacggtggtgccgatattcgtgctcaaatccgc
caaattgaccaaggttgcgacttgctttctgctactcctggtcgtttggttgatttaatc
gatcgtggtcgtatttctttggccaacattaagtttttggtgttggatgaagctgatcgt
atgctggatatgggtttcgagcctcaaattcgtcacattgtggaaggtgctgacatgaca
agcgttgaagaacgtcaaactctcatgttttctgccactttcccccgtgatatccaactt
ttagctcgtgactttttaaaggattatgtcttcttgagtgttggtcgtgtcggttccact
tcggagaatattactcaaaaggtcgtacacgttgaagattctgaaaagcgtagttacttg
cttgatattcttcacaccttacctcctgagggtcttaccttgatctttgtagagactaaa
cgcatggctgacacacttaccgactatttgttgaatagcaacttccccgcaacaagcatt
cacggtgaccgtacccaacgtgagcgtgagcgcgctttggaattgttccgctctggccgt
acttccattatggtcgctactgccgtcgccagtcgtggtttagatattcccaatgtcacg
catgttattaactacgatttacctactgacattgatgactatgtgcatagaattggtcgt
accggtcgtgctggtaacactggtcaagctgttgcgtttttcaaccgtaacaacaagggt
atcgctaaggaattgattgagttgttgcaagaggccaatcaagagtgccccagctttttg
atcgccatggctcgtgaaagcagctttggtggtaatggacgtggtggccgttacagtggt
cgtggtggtcgtggaggcaatgcttatggtgctcgcgacttccgtcgccctactaatagt
agtagtggttatagctctggccctagctactctggatacggtggctttgaaagccgtact
cctcatcatggtaacacttacaacagtggtagtgctcaatcctggtggtaa

DBGET integrated database retrieval system