KEGG   Schizosaccharomyces pombe (fission yeast): SPCC18.01c
Entry
SPCC18.01c        CDS       T00076                                 

Gene name
adg3
Definition
(RefSeq) putative beta-glucosidase Adg3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: SUN
Other DBs
NCBI-GeneID: 2539118
NCBI-ProteinID: NP_588380
PomBase: SPCC18.01c
UniProt: O74851
Position
III:complement(1948578..1951973)
AA seq 1131 aa
MPSKIEKICLLLLGFTAASNVNAYSHRRAGDTLHHRHKHEKHNDLTDSSYEPLTLSYNDT
QIQQLQRRDTVQCAFPYGDKMVAVTPDEGNAGWAMSPDQYCTAGTWCPYACEPGYLMGQW
DPNATSYTYPESMYGGLYCNSDGVAVKPFPSKDYCYPGVGDLSVVDQTGDGIAFCQTVLP
GNEAMLIPTWVAPDSEQVLAVPDISYWDETAAHYYVNPPGVSTTDGCVWGTSANPYGNWA
PYVAGANMDENNITYVKLGANPIYLDDSYWSTVKPTYGLALECEGDTCSGLPCYVDPREN
GVQGCPEGSPIGAGGACFCVVGFQQGTTAKIVVVDYSEEMASSSSSASATATSSAESSIA
TSPITSSSNVVSSISTSSMDSSAVSSYSVVQSSLASIISNAYIATSKSGLNSGVSTLLAS
PTSSSTFVTSLLRRSSIDGSASSSSASLAVPTVSSSTTGSLHYKTTTTVWVTEVFTRYLG
DDSTPVTSSSIFSTATEATDTSVQTSSAIYDSSSTSNIQSSSSVYASSTGALSSNSLSSS
TSSVSTSYIPNASSSVYASSTEALSSNSLSSSTSSASTSYIPSASSSYEVASNSSDYYSQ
TVSSITASGTTSSTSEIVSTPASNSNTGSLNGTSSFNVNSVGPSSSQTTPTSSSSITGSQ
SLKETSSPAYVSSTVSYTSSSVDSSSTYNSTGSSSSDSQSFSGTTYSDPTTTITSEVSSI
LSSPTSMQSSVSRPQSSGDASGFNTIFTSISQSSDGETSGYTISSNSSQNSASEPQTAFT
SSSSSATPTITQSSISTSVSSQSSMNSSYSSPISSNSVTSSTSIISSIASSSYTSIPSIS
SIASSFFDASGFTSIYNGTKAGFSSSFALASNSESGASDVLSSTIAKPTFKFSTSNSGST
SYSIPSSSSRNEGTTSYSSNITVTSSTLKPSLTSSVSTASSYIASSASSNTLSTEPKTFS
SSSTLSESISSINTNSLTVKPESSLSSSTTSGLTSSSSTIPSSTRSESNSESASTSSASK
RSSSSTSLVQSNPVKTVVSLESYKFTTSKISLVKNPTKTYTVTDVETNVVVQTHTVSYVE
HSTSYTWVHTTLYEYADVEASTKSTSEPSAKSKRNAVSTFETVFLKSKSSA
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgccttccaaaattgaaaaaatttgtcttttgttgttgggttttactgcagcatcaaat
gtgaatgcatactcacatcgtcgggccggtgatactttgcaccatcggcataaacatgaa
aagcacaatgatctgactgattccagttatgaaccactgactttgtcttataatgatacg
caaatccagcaattacaacgacgcgatactgtacagtgtgccttcccctatggagataag
atggtagcagtaacacccgacgaaggtaatgccggttgggcaatgtctccagatcaatat
tgcactgctggtacatggtgtccttacgcttgtgaacctggctacttaatgggacaatgg
gaccccaatgccacttcttatacttatcctgaatccatgtatggaggtttatattgcaac
tcagatggtgtggcagtcaagccatttccttcaaaggattattgttatccgggtgtcggt
gatttatccgttgtcgatcagacgggtgatggaatcgctttttgtcaaacggttctcccg
ggtaatgaagctatgctcattcctacgtgggttgcccctgattctgaacaagttttagct
gtgcccgacatctcttattgggatgaaactgctgctcattattatgtaaatccacctggc
gtatctaccactgatggttgtgtttggggtacttctgcgaatccttatggaaactgggct
ccttacgttgctggtgcaaacatggatgaaaataacattacctatgttaagttgggtgcg
aacccaatctacctcgatgattcttactggtcaactgtgaaacctacatatggtttggca
ctcgagtgtgaaggtgatacctgctctggcttaccttgctatgtcgatcctcgcgaaaat
ggtgttcaaggttgtccagagggaagtcccattggtgctggaggcgcttgcttttgtgtg
gtagggtttcagcaaggcaccactgctaaaattgttgttgttgattatagtgaagagatg
gcttctagttcttcctcggcatctgctacagcaacatcaagtgcggagtcttctatagct
acatctcctatcacttcttcaagcaacgttgtatcatcaatctcaacgtcgtctatggac
tcttctgcagtttcttcgtactcggtggtacagtcctccttggcgagcattatttcaaat
gcctacattgctacttccaagagtggccttaactcgggagtctcaaccctattggcttcg
cccacttcgtcttctacatttgtaacgtcgttgcttcgtcgctcatcaattgatggtagc
gctagtagtagctcggcttctttggctgttccaactgtttcttcctctactactggctca
ctccattataaaacgacgacaactgtatgggttacagaagtgtttactaggtatcttggt
gatgactcgactcccgtgacttctagttcaatctttagtaccgccactgaagcaacggat
acatccgttcagacatctagtgcaatttatgattcatcttcgacttcgaatatacaatct
tcctcttcagtttacgctagcagcactggagctttaagcagtaatagcttatcaagttca
acttcctcagtctctactagctatattcccaacgcttcttcttcagtttacgctagcagc
accgaagctttaagcagtaatagcttatcaagttcaacttcctcagcctctactagctat
attcccagcgcttcctcttcttacgaggtagcaagtaatagtagtgattattacagccaa
actgtgagctcaattactgcgtctggaactacatcctcaacttccgaaattgtttctact
cctgcatctaatagtaatactggttctttgaatggaactagtagcttcaatgttaatagt
gttggtccatcctcctctcagacgacacctacatcgagtagctcaatcacaggctctcag
tctttgaaagaaactagtagtcctgcttatgtttcttctacagtatcatacacgagctct
tcagttgattcgtcttctacttataattcaaccggaagttcatcatcagattctcaatca
ttttctggtaccacttacagtgacccaactactactatcactagtgaagtttcaagcatt
ttaagttctcctacctcaatgcaaagctctgtttcaagacctcagtcttccggtgatgcc
agcggatttaataccatatttacttcaatttcacagtctagtgatggtgagacttcgggt
tatacaatctcttctaattcatctcaaaattctgcatcagagccacaaaccgcttttact
tcttccagttcaagcgctactccaactattacacaaagtagtatttctacttccgtctct
tcgcaatcgtcaatgaactcgtcttatagctcaccaatttcttctaactctgtgacttct
agtacgagcattatatcgtctatagcctctagctcttatacatctatcccctccatctcc
tcaatagccagttctttctttgatgctagtgggtttacctcaatttataacggaacaaaa
gcaggattttcaagttctttcgctttggcttctaactcagaaagtggagcatccgacgta
ttaagcagtacgatcgctaaaccgactttcaaattttcaacttcgaattcggggtctact
agctattctatcccaagttccagttctcgtaacgaaggaactacatcatattcgtcgaac
attacagtcacttcatccactttgaaaccttctttaaccagttcagtatctacagcatca
agctatattgcttcttctgcttcttcaaataccttgtctacagaacccaagacgttttcg
agttcatcaaccttaagcgaatcaatttcttctattaatacaaattccttgaccgttaaa
cctgagtcatctttgagctcgtcaaccacgagtggattaacctcctcttcttccactatt
ccatcttctactaggtcggaaagcaactcagaaagtgctagtacatcttcggccagtaag
cgatcgtcatcttctacttctctcgtgcaatcaaatcctgttaagacggttgtgtccctt
gaatcatataaatttacaacgtctaagatttcgttagtgaaaaatccaacaaaaacctac
actgtaactgatgttgaaacaaatgttgttgtgcaaacccacacagtttcatatgttgag
cactcgacatcttatacttgggtccacactactctttatgagtatgcagacgtagaggca
agcacgaaatccactagcgagccaagtgcgaagtccaaaagaaatgcagtttcaacgttt
gaaacagtatttttgaaaagcaaatcctctgcgtag

DBGET integrated database retrieval system