KEGG   Schizosaccharomyces pombe (fission yeast): SPCC18.16c
Entry
SPCC18.16c        CDS       T00076                                 

Gene name
fmn1
Definition
(RefSeq) riboflavin kinase Fmn1
  KO
K00861  riboflavin kinase [EC:2.7.1.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00740  Riboflavin metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00911  Riboflavin biosynthesis, fungi, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SPCC18.16c (fmn1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     SPCC18.16c (fmn1)
SSDB
Motif
Pfam: Flavokinase
Other DBs
NCBI-GeneID: 2539192
NCBI-ProteinID: NP_588395
PomBase: SPCC18.16c
UniProt: O74866
Structure
PDB: 
1N08 1N06 1N05 1N07

Position
III:complement(1985451..1985942)
AA seq 163 aa
MTVNLEEKRPEIVGPEKVQSPYPIRFEGKVVHGFGRGSKELGIPTANISEDAIQELLRYR
DSGVYFGYAMVQKRVFPMVMSVGWNPYYKNKLRSAEVHLIERQGEDFYEEIMRVIVLGYI
RPELNYAGLDKLIEDIHTDIRVALNSMDRPSYSSYKKDPFFKV
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacagttaatttagaagaaaagaggcctgaaattgttggtcctgaaaaggtgcaaagc
ccttatcctattcgcttcgaagggaaagttgttcatggctttggtagaggctcaaaagag
cttggaattccaactgcaaatatatcagaagatgcaattcaagagcttcttagatataga
gattctggtgtttattttggatatgctatggtacaaaaacgagtattccccatggtgatg
agtgttggatggaatccgtactataaaaacaagctacgaagtgcagaagtgcatctcata
gaaagacaaggtgaagatttttacgaagaaataatgcgtgttattgttttgggatacatt
aggcctgagctaaattatgccggtttagataaattaatcgaagatatacacaccgatatt
agagttgctttaaatagcatggatcgtccttcttattctagctataagaaggacccattt
ttcaaggtataa

DBGET integrated database retrieval system