KEGG   Schizosaccharomyces pombe (fission yeast): SPCC18.18c
Entry
SPCC18.18c        CDS       T00076                                 

Gene name
fum1
Definition
(RefSeq) putative fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00020  Citrate cycle (TCA cycle)
spo00620  Pyruvate metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01200  Carbon metabolism
Module
spo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPCC18.18c (fum1)
   00620 Pyruvate metabolism
    SPCC18.18c (fum1)
Enzymes [BR:spo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     SPCC18.18c (fum1)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-GeneID: 2539345
NCBI-ProteinID: NP_588397
PomBase: SPCC18.18c
UniProt: O94552
Position
III:complement(join(1988631..1990100,1990630..1990722))
AA seq 520 aa
MASVAHISTAKAIFRAGGLPCRRLITPTLTGLPLKTHRMNSTTPTYHLIPKGGKHGEFRQ
ESDTFGPIQVPAEKYWGAQTQRSLQNFRIGGEKERLPLPLVRAFGVLKRAAASVNREFGL
DPKLADAIEQAAQEVIDGRLDDNFPLVVFQTGSGTQSNMNSNEVIANRAIEILGGTLGSK
KPVHPNDHVNMSQSSNDTFPTVMHIASVLQIHTHLLPAMKHLHRALKGKEEEFKNIIKIG
RTHMQDATPLSLGQEFSGYVTQVGYGIERINNALPRLCLLAQGGTAVGTGLNTFEGFDVK
VAEKVSKLTNIEFKTAPNKFEALAAHDAIVEMSGALNVIACSLMKIANDIRQLGSGPRCG
LGELILPANEPGSSIMPGKVNPTQCEALTMVCAQVMGNHATITVAGASGHCELNVFKPLL
AKNILSSIRLLGDACESFTDHCVVGIEPNYEGIARHLRDSLMLVTALNPHIGYDNCAKIA
KTALKNKSTLKHEFVTLGFGTPEQFDEWVRPELMISAKKV
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggcttctgttgcccacatcagcacggctaaagcgatttttcgagctggcggtttgcct
tgcagaagattgattaccccaacactcactggtttacctctaaaaactcatagaatgaat
tccactactccgacttatcatctcattcccaaaggcggtaagcatggcgagttccgacag
gaatctgacacctttggtcccatacaagtccctgcagaaaagtattggggtgctcaaact
cagcgttctcttcaaaactttcgaattggtggtgaaaaagagcgacttcctcttccctta
gttcgcgcatttggagttttaaagcgtgcggctgcttctgttaatcgtgaattcggtttg
gatcccaaacttgcagatgccattgaacaggctgcccaagaagtcattgatggtcgtttg
gatgataacttccccttggttgttttccaaactggctcgggcacccaatccaatatgaac
agtaacgaggtaatcgctaatcgtgccatagaaatccttggtggtacgttaggttcgaaa
aagcccgttcatccaaacgatcacgttaacatgtctcaatcttctaacgacactttcccc
actgttatgcatattgcctctgttttgcaaattcacactcatttacttcctgccatgaag
cacctccaccgggccttgaagggtaaggaagaggagtttaagaacattatcaaaatcggt
cgaacccacatgcaagatgccactcctctttctttaggtcaagaattttccggctatgtt
actcaggttggttatggcattgagcgcataaacaacgctcttcctcgtctttgtcttctc
gctcaaggtggtactgccgtgggtactggactaaatacttttgaaggatttgacgtgaag
gttgctgagaaggtttcaaagcttacaaatattgagtttaagaccgcccctaacaagttt
gaggctcttgcagcccatgatgcgattgtggagatgagtggtgctttaaatgttattgct
tgttctcttatgaaaattgctaacgatattcgtcaacttggttctggccctcgttgtggt
ttaggcgaattgatccttcctgctaatgaacctggaagttcaatcatgccaggcaaagta
aaccccacccaatgtgaagccttaacaatggtttgtgctcaagtaatgggcaatcatgcc
actattactgtcgctggtgcctccggacactgtgaactcaatgtttttaaacctctttta
gcaaagaacattctaagcagtattcgtcttttaggggatgcttgcgagtcttttactgat
cattgcgttgtcggcattgagccaaattacgaaggtattgcccgtcatcttcgtgattcc
ttgatgcttgttactgcgttaaatcctcacatcggttatgataactgtgccaagattgcc
aagactgctcttaaaaataagagcactctcaagcacgagtttgttactttgggtttcggt
acccccgagcaattcgatgaatgggttcgccctgaattaatgatttcagctaagaaagta
taa

DBGET integrated database retrieval system