KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1827.06c
Entry
SPCC1827.06c      CDS       T00076                                 

Definition
(RefSeq) putative aspartate semialdehyde dehydrogenase
  KO
K00133  aspartate-semialdehyde dehydrogenase [EC:1.2.1.11]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00260  Glycine, serine and threonine metabolism
spo00261  Monobactam biosynthesis
spo00270  Cysteine and methionine metabolism
spo00300  Lysine biosynthesis
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01210  2-Oxocarboxylic acid metabolism
spo01230  Biosynthesis of amino acids
Module
spo_M00017  Methionine biosynthesis, aspartate => homoserine => methionine
spo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPCC1827.06c
   00270 Cysteine and methionine metabolism
    SPCC1827.06c
   00300 Lysine biosynthesis
    SPCC1827.06c
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SPCC1827.06c
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.11  aspartate-semialdehyde dehydrogenase
     SPCC1827.06c
SSDB
Motif
Pfam: Semialdhyde_dhC Semialdhyde_dh DXP_reductoisom Sacchrp_dh_NADP DapB_N
Other DBs
NCBI-GeneID: 2539267
NCBI-ProteinID: NP_588552
PomBase: SPCC1827.06c
UniProt: P78780
Position
III:complement(join(2386150..2387186,2387491..2387527))
AA seq 357 aa
MAIKKVGILGATGTVGQRFITLLSDHPEFKIAVLGASARSAGKPYAVATKWKQSIAMPKE
ISQMSVKACDPKEFSECDIVFSGLDADFAGEIEKSFRDANLVIVSNAKNYRREPTVPLVV
PTVNTDHLDVIKYQRQENKLDRGCIITNSNCSTAAVVVPLKALQDAFGPIAQTNVVSMQA
ISGAGYPGVSSLDILDNIVPFIGGEEEKIEWETRKILGSVNSTISGYELTDNVVSAQCNR
VPVIDGHLMCISVKFAKTSPTPDQVREVLANYVSEPQKLGCYSAPKQAIYVFDDSTPDRP
QPRLDRNNENGYAVSVGRIRSDSIFDIKFVSLVHNTVLGAAGAGILNAEVAVKKGLM
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggctataaaaaaagttggaatcctcggtgcaacaggcaccgttggacagcgtttcatt
accctcctttccgatcatcctgagtttaagatcgctgttcttggcgcttctgctcgttct
gcgggaaaaccatatgcagttgctactaaatggaaacaatctattgcaatgcctaaagag
atttcccaaatgagtgtaaaggcttgtgatcccaaggagttttcggaatgcgatattgtg
tttagcggcttagatgctgactttgctggcgaaattgaaaaaagttttcgtgatgctaat
ttagtcatcgtttcgaatgctaaaaactatcgtcgtgagcctaccgtgccacttgttgtc
cccaccgtcaacacagatcatttggacgttatcaagtaccagcgtcaagaaaacaaactg
gatcgtggatgcattatcactaactctaactgttctactgctgctgttgtagtacctttg
aaagctctacaagatgcttttggtcctatcgctcaaacaaatgtagttagtatgcaagct
atttctggtgctggataccctggtgtttccagtcttgacattttggataacatcgttcca
tttattggcggtgaagaagaaaaaattgaatgggagacacgtaaaatcttgggctctgtc
aatagcacaatttctggatatgagttgactgataacgttgtttctgctcagtgcaatcgt
gttcctgttattgatggccatttgatgtgtatttctgtgaagtttgccaagacctctcct
actcctgatcaagttcgcgaagtattggcaaactatgtttctgaacctcaaaagttaggc
tgctacagtgcccctaaacaagccatttatgttttcgatgattctactcctgaccgccct
caacctagactcgatcgtaacaatgaaaatggttatgcagtatcagttggtcgtatcaga
tctgattccatctttgatattaaatttgtctccctcgtccataacacagttttgggtgct
gctggtgctggtattttgaatgctgaagttgcggtgaagaagggacttatgtaa

DBGET integrated database retrieval system