KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1840.05c
Entry
SPCC1840.05c      CDS       T00076                                 

Definition
(RefSeq) putative phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00010  Glycolysis / Gluconeogenesis
spo00030  Pentose phosphate pathway
spo00052  Galactose metabolism
spo00230  Purine metabolism
spo00500  Starch and sucrose metabolism
spo00520  Amino sugar and nucleotide sugar metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
Module
spo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPCC1840.05c
   00030 Pentose phosphate pathway
    SPCC1840.05c
   00052 Galactose metabolism
    SPCC1840.05c
   00500 Starch and sucrose metabolism
    SPCC1840.05c
   00520 Amino sugar and nucleotide sugar metabolism
    SPCC1840.05c
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPCC1840.05c
Enzymes [BR:spo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SPCC1840.05c
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV FtsH_ext
Other DBs
NCBI-GeneID: 2538920
NCBI-ProteinID: NP_588504
PomBase: SPCC1840.05c
UniProt: O74478
Position
III:complement(join(2265658..2267270,2267708..2267807,2267870..2267920))
AA seq 587 aa
MDPILQELVDEWFKLDQDETTRNEVSQLIKAEDYATLKQIMHPRIGFGTSGLRAEIGAGF
ARMNCLTVIQASQGFAEYLLQTVPSAAKLGVVIGHDHRHKSNTFARLTAAVFLQKGFKTY
FFDHLVHTPLVPFAVKTLGTAAGVMITASHNPAAYNGYKVYWGNGCAIIPPHDKGIAACI
EKNLTPITWDKNLVENHKLADRDFAVGLLKNYWSQLHEFHSENNFSLEMKSLKFVYTPIH
GVGLPFVTSALHLFGEQGDMISVPLQDSPNPDFPTVKFPNPEEEGALDLAYEQADANGIS
YVLATDPDADRFAFAEKINGAWRRFTGDEVGCILAYFIFQEYKNVGKPIDDFYVLSTTVS
SAMVKSMAKVEGFHHVETLTGFKWLGNKALELEKQGKFIGLAYEEALGYMVGSIVRDKDG
VNALITFLHLLKRLQLQNLSITEVFEQMSKKYGYYTTQNSYFLSRDTPKLRALVDALRHY
DTKSGYPATLGSKKITNVRDLTTGYDSSSTDGKATLPVSKSSDNVTFELENGEVIMTIRT
SGTEPKLKFYICARGHSLEDSIKNATEVKQAIKSEWFHPQQNGLEEP
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggatccgattttgcaagaattagtagatgagtggttcaaattagatcaagatgaaact
acgaggaatgaagtttcacaattgattaaggctgaagattatgccaccctcaagcaaatt
atgcatccaaggattggatttggtacatctggtttgagagctgaaattggtgctggcttc
gctcgcatgaactgtttgaccgtgattcaagcctcacaaggcttcgctgagtatttgctt
caaaccgtaccatcagctgcaaagctgggtgtggtaattggacacgatcataggcataag
tctaatacttttgctcgacttactgctgcagtgttcttgcaaaaaggattcaaaacgtat
ttcttcgatcatcttgtccatacccctttagtcccttttgccgttaaaaccctagggact
gcagctggtgttatgattactgcttcccataatcccgcagcttataacggatacaaggtc
tattggggaaacggttgtgctatcattcctccccatgacaagggaattgctgcatgtata
gaaaaaaacttaacgcccattacttgggacaaaaatttggttgaaaatcataaactagca
gatcgggattttgcagttggtcttttaaaaaactattggtctcagctccacgaattccat
tccgaaaacaacttttccttggaaatgaaatctttgaaatttgtttacactcctattcat
ggcgttggattaccatttgttacttcagcattacacttatttggcgaacaaggcgatatg
atttctgtacctcttcaagattctccaaaccctgactttccgactgtgaaatttccaaat
ccagaagaggagggggcattggatttggcttacgagcaagctgatgctaatggtatttcg
tatgtccttgcaactgatcctgacgcagatcgtttcgcctttgcagaaaaaattaatggt
gcttggagaagatttaccggagatgaagttggttgtatccttgcctattttatatttcaa
gaatacaaaaacgttggaaagccaattgatgatttttacgttttgtcaactactgtctct
agtgctatggtaaagtccatggccaaagtagaaggattccatcatgttgaaacacttact
ggatttaagtggttaggcaataaagcattagaattggaaaaacaagggaaatttattgga
ttggcatatgaagaagctcttggttatatggtaggtagtatagttagagacaaagacggg
gttaatgctttgattacgttccttcatcttttgaaacgccttcaacttcagaatctttca
attaccgaggtttttgagcaaatgtctaaaaaatatggttattacactacgcaaaactca
tatttcctttcacgcgacactcccaagcttcgtgctttggttgatgccttgagacattat
gacacaaaatcgggttatccggcaacccttggtagtaagaaaattacaaatgttcgcgac
cttactacaggttacgactcaagctccacggatggtaaagctactttaccagtttcaaaa
agttcagataacgtaacgtttgagcttgaaaatggagaggtaattatgactattcgcaca
agtggtacagagccgaaacttaagttttatatctgtgctcgcggacattcgcttgaagat
tccataaagaatgctacagaagttaaacaggctatcaaatctgaatggtttcatccccaa
cagaacggactggaagagccatga

DBGET integrated database retrieval system