KEGG   Schizosaccharomyces pombe (fission yeast): SPCC188.07Help
Entry
SPCC188.07        CDS       T00076                                 

Gene name
ccq1
Definition
(RefSeq) telomere maintenance protein Ccq1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1660 R3H DUF4200 Retrotrans_gag DUF5488 DUF3450
Motif
Other DBs
NCBI-GeneID: 2539352
NCBI-ProteinID: NP_588210
PomBase: SPCC188.07
UniProt: Q10432
Position
III:1486303..1488510
Genome map
AA seq 735 aa AA seqDB search
MSEINDFTNSIIINESDTKYEVYSEVNSSNRWIAKEDCPSPLEDVWLLKLAGHKRKLEEP
LSCMRNEEPASKQREIEKFLRTDLDHSENDFLTQEVDEFPSTQQLFPIPLQNDTAFDSSE
ESITKSSKSSFSVLDIGLPMSALQRKMMHRLVQYFAFCIDHFCTGPSDSRIQEKIRLFIQ
SAHNIAKHPSLYDTEVRNPSAAESTNSHVSLDASNFSSYAENSSKFLFLQELFKNLSPSY
SKTFFLFISNQFLANTLTQWLKSQNIDAELWAEEDAKTSQHPAIWICVSKKAPSASHFLQ
SCPDLSATIFYDIEAYMSVTSSLPSIQSLVLRLIHLGSIEHAIKCFQSSYNASFLVNIVG
VVATLSSSSEENSEASNLSTLFEKSGNFEEILGSESHSSITEKTRDIAKNVATWLKNGEN
FSSWPLPPLMDLASLSVAEPRDSQPSVSQVNDTFVKSSDSTFPSSQSMQSPSKLHSLTSN
ATDLLSSSSLKKNFFSQQEADEVELSNNYDLQGAAVQYLQRRLRMVEDELHEAINSKNVQ
QSRSEELEQQISKLTDNLQEYRNTVRELKLDLEKSKKKNEDLSKLEVEKVEEIANLKKEL
THLAKQQEFGFKYVQEFSNEDLQGKLIEANEKNYKLTQLLKTQKEDADFITNQYQNASTF
AAEQSKEVAKLQAECKRLQAINSKVMEEVKVYNDSRVEALLAKVSSLEETLKILEQKSLP
KFTPHNQSPRIIDSN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaattaacgactttacgaattcaattattatcaatgaaagtgatacgaaatac
gaggtttactctgaggtgaattccagtaatagatggattgccaaagaggattgccctagc
ccgttggaagatgtatggcttctaaaattagcaggccataagagaaaattggaagagcct
ctaagttgcatgcgtaatgaagaacctgcatccaaacaaagagagatagaaaaattttta
cggactgatttggatcactctgaaaatgactttttaactcaagaggtcgatgaattccct
tctacccagcagttatttcctattcctttgcaaaatgacactgcctttgattcttcggaa
gaatctattactaaatcttctaaatcctcgttcagcgtgctagatattggccttccaatg
tctgcgcttcaaaggaaaatgatgcatcggttggttcaatactttgccttttgtattgac
catttttgtactggtcctagcgattcaagaatccaagaaaaaatacgtctttttattcaa
tctgctcataacattgcaaagcatcctagtctgtatgatactgaagttcgaaatccctcc
gctgctgaatccactaattcccacgtttctttagatgcttctaatttctcttcatatgcc
gaaaattcttcaaaatttctttttttgcaagaattattcaaaaatctttccccctcttat
tctaagacattttttttatttatctccaaccaatttcttgcaaacacacttactcaatgg
ctaaaatctcaaaacattgatgctgagttatgggctgaagaggatgcaaagactagccaa
catccagcaatttggatttgtgtgtccaaaaaggctccctccgcttctcattttcttcaa
tcttgcccagatttgagtgcaaccattttttatgatatcgaagcatacatgagtgtcact
agttccttgccctctattcaaagccttgtccttaggctcattcacttgggatctatagaa
catgccataaaatgttttcaatcatcttacaatgcctcatttttagtgaacattgtgggt
gtggttgccactcttagttcttcttccgaggaaaattcagaagcttcaaatttgagcact
ttgtttgagaaatctgggaactttgaggaaatcctaggctcagaatctcactcttctatt
acagaaaaaactcgagatattgctaaaaatgttgcgacctggttaaaaaatggagaaaac
ttctcttcttggccactacctcctctaatggatttagcaagcttatcggttgcagaacca
agggattctcagccttctgtttctcaggtgaacgatacttttgtcaaatcatctgatagt
acatttccttcgtcgcaaagcatgcaatcaccttccaaactccactctttaacaagtaat
gccaccgatttactgtcatcaagctcactaaagaaaaactttttttctcaacaggaagct
gatgaggtagaactttccaataattatgatctccaaggtgcagctgtccaatacctgcag
cgtcgtttaagaatggtagaagatgaattacacgaagccattaattccaaaaacgtacaa
caaagtcgctcagaggagttggagcagcaaatttctaagctgacggataatttacaagaa
tacagaaacactgttcgagagctcaagctggatttggagaaatcgaagaaaaagaatgaa
gacctttcaaagctagaagttgagaaggttgaagaaatcgcaaaccttaaaaaagagctt
acccacttagctaagcaacaagaatttggctttaaatatgtacaagaattttcgaatgaa
gatctacaaggcaaattaattgaagccaacgaaaaaaattacaaacttactcaactgtta
aaaacacagaaagaagacgctgatttcattactaatcaatatcaaaatgcatctactttt
gctgctgagcaaagcaaagaggttgcgaaacttcaagctgaatgtaagcgcttacaagct
ataaattctaaagttatggaagaggtaaaagtttataatgattcaagggtagaagcatta
ctcgctaaggtctcttctctggaggagaccttaaaaattttagagcagaagtctcttccc
aaatttactccacataatcaatcaccaaggattattgattctaactaa

DBGET integrated database retrieval system