KEGG   Schizosaccharomyces pombe (fission yeast): SPCC188.13cHelp
Entry
SPCC188.13c       CDS       T00076                                 

Gene name
dcr1
Definition
(RefSeq) dicer
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC188.13c (dcr1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     SPCC188.13c (dcr1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    SPCC188.13c (dcr1)
   microRNA pathway
    RISC loading complex
     SPCC188.13c (dcr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuclease_3 Ribonucleas_3_3 Helicase_C Dicer_dimer ResIII DEAD SNF2_N AAA_22
Motif
Other DBs
NCBI-GeneID: 2538930
NCBI-ProteinID: NP_588215
PomBase: SPCC188.13c
UniProt: Q09884
Structure
PDB: 

Position
III:complement(1506166..1510290)
Genome map
AA seq 1374 aa AA seqDB search
MDISSFLLPQLLRKYQQDVYNIASKQNTLLVMRTGAGKTLLAVKLIKQKLEEQILIQESN
LEHKKISVFLVNKVPLVFQQAEYIRSQLPAKVGMFYGELSIEMSEQLLTNIILKYNVIVI
TADLFYLFLARGFLSINDLNLIIFDECHHAIGNDAYARIMNDFYHRAKAVLSKKHFTLPR
IFGMTASPFTGKKGNLYHRLYQWEQLFDSKAHVVSENELADYFCLPEESYVMYSNKLVVP
PSDSIIKKCEETLQGCKLISRAVKTALAETIDMGLWFGEQVWLYLVDFVETKRLKKKALG
KQLSDDEELAIDRLKIFVEDWKNNKYSDNGPRIPVFDSTDVTDKVFKLLELLKATYRKSD
SVRTVIFVERKATAFTLSLFMKTLNLPNIRAHSFIGHGPSDQGEFSMTFRRQKDTLHKFK
TGKYNVLIATAVAEEGIDVPSCNLVIRFNICRTVTQYVQSRGRARAMASKFLIFLNTEEL
LIHERILHEEKNLKFALSELSNSNIFDSLVCEERERVTDDIVYEVGETGALLTGLYAVSL
LYNFCNTLSRDVYTRYYPTFTAQPCLSGWYCFEVELPKACKVPAAQGSPAKSIRKAKQNA
AFIMCLDLIRMGLIDKHLKPLDFRRKIADLETLEEDELKDEGYIETYERYVPKSWMKVPE
DITRCFVSLLYTDANEGDNHIFHPLVFVQAHSFPKIDSFILNSTVGPRVKIVLETIEDSF
KIDSHLLELLKKSTRYLLQFGLSTSLEQQIPTPYWLAPLNLSCTDYRFLENLIDVDTIQN
FFKLPEPVQNVTDLQSDTVLLVNPQSIYEQYAFEGFVNSEFMIPAKKKDKAPSALCKKLP
LRLNYSLWGNRAKSIPKSQQVRSFYINDLYILPVSRHLKNSALLIPSILYHIENLLVASS
FIEHFRLDCKIDTACQALTSAESQLNFDYDRLEFYGDCFLKLGASITVFLKFPDTQEYQL
HFNRKKIISNCNLYKVAIDCELPKYALSTPLEIRHWCPYGFQKSTSDKCRYAVLQKLSVK
RIADMVEASIGACLLDSGLDSALKICKSLSVGLLDISNWDEWNNYFDLNTYADSLRNVQF
PYSSYIEETIGYSFKNKKLLHLAFIHPSMMSQQGIYENYQQLEFLGDAVLDYIIVQYLYK
KYPNATSGELTDYKSFYVCNKSLSYIGFVLNLHKYIQHESAAMCDAIFEYQELIEAFRET
ASENPWFWFEIDSPKFISDTLEAMICAIFLDSGFSLQSLQFVLPLFLNSLGDATHTKAKG
DIEHKVYQLLKDQGCEDFGTKCVIEEVKSSHKTLLNTELHLTKYYGFSFFRHGNIVAYGK
SRKVANAKYIMKQRLLKLLEDKSNLLLYSCNCKFSKKKPSDEQIKGDGKVKSLT
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atggatatttcaagttttctacttcctcaacttttacgtaaatatcaacaagatgtgtat
aatatcgcgagcaagcaaaatactttacttgttatgagaacgggcgctggtaagacatta
cttgctgtgaagttgataaaacaaaagctcgaggagcaaattttaatccaagaatcaaat
cttgaacataaaaaaatatcagtttttctcgtcaacaaagtccctttggtatttcaacaa
gcggaatacattcgatctcaactaccggctaaggttggcatgttttatggcgaattatct
atagaaatgagcgagcagttgttgactaatattatattgaagtataatgtgattgttatt
actgcagatttgttctatttgtttcttgcaagaggttttctttcaataaatgatttgaat
ttaattatattcgacgaatgtcatcatgcaattggaaatgatgcgtatgctcgcatcatg
aatgatttttatcacagagccaaagcagtattgtcaaaaaaacatttcaccctaccaaga
atttttggtatgactgcttcaccattcactggaaaaaaaggaaacttataccatcgactg
tatcaatgggagcaattatttgattctaaagcacacgtggtttcggaaaacgagctagcc
gattacttctgtcttcccgaagaaagctatgtaatgtattccaataagttggttgtgcca
ccctcggattctattatcaagaaatgcgaggaaactcttcaaggatgcaagttaatttct
cgggctgttaagactgctttagcagaaaccatagatatgggtctttggtttggggagcaa
gtttggttatatttggttgattttgtggaaacgaaaagattaaaaaaaaaggctttaggg
aagcagttgtcagatgacgaggaactggcaattgaccggttaaaaatatttgttgaagat
tggaaaaataacaaatattcagacaatggccctagaatccctgtttttgattccactgat
gttactgataaagtctttaaactcttagaattgttaaaggctacttaccgcaaaagtgat
agcgttcgtacggttattttcgttgaaagaaaagctacggcgtttactttaagtttgttt
atgaaaactcttaatctgcctaacatccgcgctcattcttttataggacatggaccgtcc
gatcagggtgaattttctatgacattcaggaggcaaaaagatacccttcataagtttaag
actggaaaatataatgttttaattgctactgcagttgcagaagaaggtatcgatgtacca
tcatgtaacttagttatacgcttcaatatttgtcggactgtcacccagtatgtccaatct
cgaggtagagcgagagcaatggcttcaaagtttctaatttttttaaacacagaagagttg
ttaattcatgaacgcattctacacgaagaaaaaaatcttaaatttgccctttcagagctc
agcaattcgaatatttttgattcattggtatgtgaggaaagagaacgtgtgactgatgat
atcgtctatgaagttggcgagactggtgctttactcacagggttgtatgcagttagtctg
ctttataacttttgtaacacactttcaagagacgtatacacaagatattatcccactttt
acagctcaaccctgtctttcaggttggtattgttttgaggtagaattgccaaaagcctgc
aaagttccagcggctcaaggatctcccgctaaatcaattaggaaagccaaacagaatgct
gcgttcatcatgtgtttggatctgattcgtatgggtcttatagacaaacatttaaaaccc
ctagattttagaagaaaaattgccgaccttgaaactcttgaggaagacgagctaaaagat
gaaggttatatcgagacatatgagcgctatgtaccaaaaagttggatgaaagttcctgaa
gatattacacgttgcttcgtctctttactttatactgatgctaatgaaggagacaatcat
atattccatcccttagtgtttgtacaagctcattcattccccaaaattgatagctttatt
cttaattcgactgttggcccccgagttaaaattgttttagaaacgattgaggatagtttt
aagatcgattctcatctgcttgagttgttaaaaaaatcaactcgttatctacttcaattc
ggtttatctacttctcttgagcaacaaatacctactccttactggcttgcgcctttaaat
ttgtcatgcacggattaccggttcttagaaaatctgatagatgttgacactatccaaaat
ttttttaaattaccggaacctgttcaaaatgttactgatttgcaatccgatactgtatta
ttagtaaatccacagtcaatatatgaacagtatgcttttgagggatttgtcaattctgaa
tttatgattcctgctaaaaagaaagataaggccccttctgccttatgtaagaaacttcct
ttacgattaaattattcactttggggcaatagagctaaatccattcccaaatcacagcaa
gtgcgcagtttttatatcaatgacctctatattctcccagtctctagacatttgaaaaac
agcgccttgctaataccctccatactgtaccatattgaaaacttattggtcgcctcttct
tttatcgaacactttcgacttgattgtaaaattgacactgcttgtcaggctttaacatct
gcggaatcacaattgaattttgattacgatcgtctagagttttacggagactgctttcta
aaattgggtgcttctattacagtttttttgaaatttcctgatactcaagagtaccaactg
cattttaatcgaaagaaaattattagcaactgtaatttgtataaagtagcaatagattgt
gagttgccgaagtatgctctctcgactcccttggaaatccgtcattggtgtccatatggt
tttcagaaaagcacatcggataagtgccgctacgccgttttacagaaattatcggttaag
aggatagcagatatggtcgaagctagtatcggtgcatgtcttttagacagtggacttgac
tcagcactcaagatctgtaaatctttaagcgttggtctgctggatatcagcaattgggat
gagtggaacaattattttgatttaaatacatatgcggattcactgagaaatgttcaattc
ccttactcctcgtatatagaggaaactattggatattcatttaaaaacaagaaactactc
catttggcatttattcatccttccatgatgtctcagcaaggtatttacgaaaactatcaa
cagttggagtttttgggtgatgctgtattggattacattatcgtacaatacctttataaa
aagtatcctaacgcaacttctggcgaattaactgattacaaatctttttatgtgtgtaac
aagagtctatcatacattggctttgttttgaatttgcacaaatatatccaacatgaaagc
gcagcaatgtgtgatgcaatatttgaatatcaagaattaattgaagcgttcagggagact
gcttcagagaatccgtggttctggtttgaaattgattcaccaaagttcatttcagatact
ttagaagctatgatatgtgccatttttttggattctgggtttagtttacaatctctacaa
ttcgttttacctctttttcttaattcgttaggggatgcgacacatactaaggctaaagga
gatattgaacacaaggtataccaattactgaaagatcagggatgtgaagacttcggaaca
aagtgtgtcatcgaggaggtgaaatccagtcacaaaacattgttaaatactgaactccat
ttaacaaagtattatgggttttcattcttccgccacgggaatattgttgcttacggcaaa
tcccgtaaagttgccaatgcaaagtatattatgaaacaaagacttctcaaattgttagag
gataagtctaacttacttttgtattcttgtaattgcaaatttagtaagaaaaagccatca
gatgagcaaataaaaggagatggaaaagttaaaagtttgacttga

DBGET integrated database retrieval system