KEGG   Schizosaccharomyces pombe (fission yeast): SPCC191.07
Entry
SPCC191.07        CDS       T00076                                 

Symbol
cyc1
Name
(RefSeq) putative cytochrome c
  KO
K08738  cytochrome c
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00190  Oxidative phosphorylation
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPCC191.07 (cyc1)
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG Cytochrom_C550
Other DBs
NCBI-GeneID: 2539146
NCBI-ProteinID: NP_588296
PomBase: SPCC191.07
UniProt: P00046
Position
III:1714735..1715064
AA seq 109 aa
MPYAPGDEKKGASLFKTRCAQCHTVEKGGANKVGPNLHGVFGRKTGQAEGFSYTEANRDK
GITWDEETLFAYLENPKKYIPGTKMAFAGFKKPADRNNVITYLKKATSE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgccttacgctcctggagacgaaaagaagggtgcttccctgttcaagactcgttgcgct
caatgtcataccgttgaaaaaggcggcgccaacaaggtcggtcccaatttgcacggtgta
tttggccgtaagaccggtcaagctgagggtttctcttacaccgaagccaatcgcgataag
ggtattacttgggatgaagaaactcttttcgcctacctcgaaaaccccaagaagtatatc
cccggtactaagatggcctttgctggcttcaagaaaccggctgatcgtaacaacgtcatt
acgtatttgaagaaggccacctctgagtaa

DBGET integrated database retrieval system