KEGG   Schizosaccharomyces pombe (fission yeast): SPCC191.09c
Entry
SPCC191.09c       CDS       T00076                                 

Symbol
gst1
Name
(RefSeq) glutathione S-transferase Gst1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00480  Glutathione metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SPCC191.09c (gst1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spo02000]
    SPCC191.09c (gst1)
Enzymes [BR:spo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     SPCC191.09c (gst1)
Transporters [BR:spo02000]
 Other transporters
  Pores ion channels [TC:1]
   SPCC191.09c (gst1)
SSDB
Motif
Pfam: GST_N GST_N_2 GST_C GST_N_3 GST_C_2 GST_C_3
Other DBs
NCBI-GeneID: 2538694
NCBI-ProteinID: NP_588298
PomBase: SPCC191.09c
UniProt: Q9Y7Q2
Position
III:complement(1719325..1720014)
AA seq 229 aa
MAQFTLWSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPEHLALNPNGRVPTLID
HHNNDYTIWESDAILIYLADKYDTERKISLPRDHPEYYKVIQYLFFQASGQGIIWGQAGW
FSVYHQELVISAITRYRNEIKRVLGVLEDILKDRDYLVANRFTIADLSFISWNNFLEIIF
AEGKFSIEEEVPQLDFEKEFPRTYSWHQRLLARPASKATFEERSKALDN
NT seq 690 nt   +upstreamnt  +downstreamnt
atggctcaattcactttatggtcgcatgctcatggtcctaatccatggaaggtggttcaa
gcgctgaaggagttggaccttacctatgaaaccagatatgtgaatttttcaaaaaatgag
cagaaatcccccgaacacttagccttaaaccctaacggtagagtacctaccttgattgat
caccacaataacgattataccatttgggaatctgatgccattttaatctatttagctgac
aaatatgatacggaaaggaagatatctttgcctcgtgaccatcctgaatactacaaagtt
atacaatatttattttttcaagcttctggccaaggcatcatttggggacaggctggatgg
tttagcgtctatcatcaggagctagtcatatctgccattacccgttataggaatgaaatc
aaacgtgttctaggagtcctcgaagatatccttaaagaccgtgattatctcgtggccaac
cggttcacaattgctgacttatcattcatttcatggaataacttccttgaaattattttt
gcagaaggaaagttttcaatcgaggaagaagtgcctcagctcgactttgaaaaagagttt
cctagaacttattcctggcatcaaagacttcttgccagacctgctagcaaggctaccttc
gaagaaagatcaaaggctttggataattaa

DBGET integrated database retrieval system