KEGG   Schizosaccharomyces pombe (fission yeast): SPCC191.11Help
Entry
SPCC191.11        CDS       T00076                                 

Gene name
inv1
Definition
(RefSeq) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00052  Galactose metabolism
spo00500  Starch and sucrose metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPCC191.11 (inv1)
   00500 Starch and sucrose metabolism
    SPCC191.11 (inv1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SPCC191.11 (inv1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 2539227
NCBI-ProteinID: NP_588300
PomBase: SPCC191.11
UniProt: O59852
Position
III:1724306..1726051
Genome map
AA seq 581 aa AA seqDB search
MFLKYILASGICLVSLLSSTNAAPRHLYVKRYPVIYNASNITEVSNSTTVPPPPFVNTTA
PNGTCLGNYNEYLPSGYYNATDRPKIHFTPSSGFMNDPNGLVYTGGVYHMFFQYSPKTLT
AGEVHWGHTVSKDLIHWENYPIAIYPDEHENGVLSLPFSGSAVVDVHNSSGLFSNDTIPE
ERIVLIYTDHWTGVAERQAIAYTTDGGYTFKKYSGNPVLDINSLQFRDPKVIWDFDANRW
VMIVAMSQNYGIAFYSSYDLIHWTELSVFSTSGYLGLQYECPGMARVPVEGTDEYKWVLF
ISINPGAPLGGSVVQYFVGDWNGTNFVPDDGQTRFVDLGKDFYASALYHSSSANADVIGV
GWASNWQYTNQAPTQVFRSAMTVARKFTLRDVPQNPMTNLTSLIQTPLNVSLLRDETLFT
APVINSSSSLSGSPITLPSNTAFEFNVTLSINYTEGCTTGYCLGRIIIDSDDPYRLQSIS
VDVDFAASTLVINRAKAQMGWFNSLFTPSFANDIYIYGNVTLYGIVDNGLLELYVNNGEK
TYTNDFFFLQGATPGQISFAAFQGVSFNNVTVTPLKTIWNC
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgaaatatattttagctagtggcatttgcctcgtctctctcttatcatctaca
aacgcggctccccgtcacttatatgtaaaacgttatcctgtcatttataatgcttccaac
atcactgaagtcagcaattctaccaccgttcctcctcctccattcgtaaatacaacggcc
cctaatgggacttgtttgggtaactataacgagtatcttccttcaggatattacaatgct
accgatcgtcccaaaattcattttactccttcttccggtttcatgaatgatccaaacgga
ttggtatatactggcggcgtctatcacatgttcttccaatattcaccaaaaactctaaca
gccggcgaagttcattggggtcacacagtttccaaggatttaatccattgggagaattat
cctattgccatctaccccgatgaacatgaaaacggagttttgtccctcccatttagtggc
agtgcagtcgtcgatgttcataattcttccggtctcttttccaacgacaccattccggaa
gagcgcattgttttaatttataccgatcattggactggtgttgctgagcgtcaggctatt
gcgtataccactgatggtggatatactttcaaaaaatattcaggaaatcccgttcttgac
attaattcacttcaattccgcgaccccaaggtaatatgggatttcgatgctaatcgttgg
gtgatgattgtagctatgtctcaaaattatggaattgccttttattcctcctatgacttg
attcactggaccgagttatctgttttctccacttctggttatttggggttgcaatatgaa
tgccctggaatggctcgtgtgcccgttgaaggcaccgatgaatacaaatgggtactcttc
atctccatcaatcctggcgctccattgggaggatccgttgtccaatactttgttggcgat
tggaatggtacaaacttcgtccccgatgatggccaaactagattcgtagacttgggtaag
gacttttacgccagcgctttgtatcactcgtcttccgccaatgccgatgttattggagtt
ggatgggctagcaactggcaatacaccaaccaagctcctactcaagttttccgcagtgct
atgacagttgcacgaaaattcactcttcgcgacgttcctcagaaccccatgaccaacctt
acttctctcattcaaaccccattgaatgtttctctcttacgagatgaaacactatttacc
gcacccgttatcaatagttcaagtagtctttcgggctctccgattactcttccaagcaat
accgcattcgagttcaatgtcacactcagtatcaattacacagaaggctgcacaacagga
tattgtctggggcgtattatcattgattctgatgatccatacagattacaatccatctcc
gtggacgttgattttgcagctagcactttagtcattaatcgtgccaaagctcagatggga
tggtttaattcacttttcacgccttcttttgccaacgatatttacatttatggaaacgta
actttgtatggtattgttgacaatggattgcttgaactgtatgtcaataatggcgaaaaa
acttacactaatgactttttcttccttcaaggagcaacacctggacagatcagcttcgct
gctttccaaggcgtttctttcaataatgttaccgttacgccattaaagactatctggaat
tgctaa

DBGET integrated database retrieval system