KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1919.11
Entry
SPCC1919.11       CDS       T00076                                 

Gene name
mug137
Definition
(RefSeq) BAR adaptor protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: BAR SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 2539113
NCBI-ProteinID: NP_588493
PomBase: SPCC1919.11
UniProt: O94478
Position
III:join(2231761..2231786,2231853..2231862,2231970..2232045,2232089..2232136,2232194..2232298,2232337..2232895,2232943..2233381)
AA seq 420 aa
MVSRFFSWTNEKPLGDQRAHLPDSFLELEQEIAIREEGLSKLFQATTIWIDSILKKVDGE
DKEKCLACENLGKVMINHSKELPQDSSYGITLSQLGKANLKIGEHQTSLAYKARVCYLDF
LKRYLVQAKDFHSARKKLESRRQAYESLLQKSFKEKKEDSRLEEDIRLALYKFEESTEQV
KNRMIALKDVEADQYQQLTELIVYELNFFKESTGILNTIFNSQNSLTPQKKIQSSERSVE
NEFLASPMDPSLSKLFTKTTNTEKISPTPFSTPKRKSKKETVFVKAIYSFTGRNEKELDL
HTGDVIQVSEQLGPDWYMGEKVNSKAEKLGNSGMFPVNYCTRIYDLHVQKSHETRSLERA
RSIRRIVSDDPRDYCSPIKQSPIQNLKFLDSDNSLLSSQNVEASSQPIKIRKPLPEIPNK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggtgtctagatttttttcttggacaaacgaaaaaccattgggagaccaaagagcacac
ttgcctgatagttttcttgaacttgagcaagaaatagcgattcgagaagaaggactatct
aaactatttcaagcaacgacaatatggattgattcaattttaaaaaaggtcgatggtgag
gataaagaaaaatgtcttgcttgtgaaaatctagggaaagtgatgataaatcattcaaaa
gagttaccacaagactcaagctatgggatcaccttgtcgcaattaggaaaagccaatcta
aagattggagaacatcaaacgtctttagcatacaaagcgagagtatgttatctcgatttt
ttaaaacgttatctagtacaagccaaggattttcattctgcaagaaaaaaattggaaagc
cgaagacaagcatacgaatctctcctacaaaagtcttttaaagaaaagaaggaagattcg
cgtttagaagaagatattcgcctggcgctgtacaagttcgaagaatccaccgagcaagta
aagaatcggatgatcgcattaaaagacgttgaggctgatcagtaccaacaattaacagaa
ctaattgtttatgagctaaacttctttaaagagtcgactggtattttaaatacaatattc
aactctcaaaactcattgacgcctcagaaaaagatccaaagtagcgaaagaagcgttgaa
aatgaatttcttgcatcacccatggatccatcacttagtaagttatttactaagaccact
aatactgaaaaaatatcaccaacaccgttttctactccgaaaagaaaatcgaaaaaggaa
acagttttcgtcaaagcaatttattcatttacgggaaggaatgaaaaagagctcgatttg
cacacaggggatgtcattcaggtgagcgaacaacttggaccggattggtacatgggcgag
aaggtaaatagtaaggcagaaaaacttgggaattcaggaatgtttcctgtaaactattgc
actaggatatatgacctccatgttcaaaaatcacatgaaacgagatctctcgagagggcg
cgttcaatcagacgaattgtaagtgatgatcctagggattattgttcacctatcaaacaa
tctcctatacaaaacctcaaattccttgacagtgataactctctcttgagtagtcagaat
gttgaagcttcttcccaaccaattaagataagaaagccattacctgaaattccgaataaa
taa

DBGET integrated database retrieval system