KEGG   Schizosaccharomyces pombe (fission yeast): SPCC1919.13c
Entry
SPCC1919.13c      CDS       T00076                                 

Definition
(RefSeq) putative ribosome biogenesis protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DUF2431 Baculo_VP39
Other DBs
NCBI-GeneID: 2539319
NCBI-ProteinID: NP_588495
PomBase: SPCC1919.13c
UniProt: O94480
Position
III:complement(join(2236152..2236513,2236637..2237123))
AA seq 282 aa
MGKKARFKEARRLQKRNLNNAIGSSSINSQNSLTNDKIGKGKNKGPTERYVLPFEKNNRF
LLLGEGNFSFAFSLLLHHVSSEGFVLATSYDSKEDLKQKYPDAAEYISKIEINGGKVMHE
IDATKLHLHKKLKTQKFDTIFWNFPHSGKGIKDQDRNILDNQKMLLAFFKASKFLLSEKG
VIVITLAETKPYTLWNLKGLAKDAGYTSLMTEKFDSSFYPEYSHRRTIGWIDGISERSPW
KGELRDSRHYCFVVNGSNIKPYNQRKEKRKRSELSDDSSDSS
NT seq 849 nt   +upstreamnt  +downstreamnt
atggggaaaaaggctcgttttaaagaagcaagacgtcttcaaaaaagaaatttaaataat
gctattggttcgtcaagtataaatagccagaattctttaacaaacgacaaaattggaaaa
gggaagaacaaaggccccactgagcgatatgtactcccatttgaaaaaaacaatagattt
ctattattgggagaaggcaacttttcgtttgctttttcattattgctacatcatgtatca
tctgaggggtttgtgttagctaccagctatgactctaaagaagatttaaagcagaaatat
ccagatgctgctgaatacatctcaaaaatagaaataaatgggggaaaggttatgcatgaa
attgatgcaacgaaactgcatctgcataaaaagcttaagacacaaaaatttgatactata
ttttggaattttcctcactcggggaaaggaattaaggatcaagaccgcaacattttggat
aatcaaaaaatgcttcttgccttttttaaagcatctaaattccttctgtcagaaaaaggc
gtaattgtaataactttagcggagaccaaaccttacactttgtggaatttgaaaggttta
gccaaggatgcagggtatacgagtctgatgactgaaaagtttgactcttctttttatccc
gaatattcacacagaagaactatcggttggattgatggaatcagcgagagatcgccatgg
aaaggtgaattgcgagattcacgacattattgctttgtggtgaatggaagtaatataaag
ccttacaaccagaggaaggaaaaaaggaagcgtagtgagctctccgatgattcaagtgat
tcttcctaa

DBGET integrated database retrieval system