KEGG   Schizosaccharomyces pombe (fission yeast): SPCC23B6.03c
Entry
SPCC23B6.03c      CDS       T00076                                 

Gene name
tel1
Definition
(RefSeq) ATM checkpoint kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SPCC23B6.03c (tel1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPCC23B6.03c (tel1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPCC23B6.03c (tel1)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC23B6.03c (tel1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPCC23B6.03c (tel1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   SPCC23B6.03c (tel1)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     SPCC23B6.03c (tel1)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    SPCC23B6.03c (tel1)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 2539209
NCBI-ProteinID: NP_588126
PomBase: SPCC23B6.03c
UniProt: O74630
Position
III:complement(1268997..1277435)
AA seq 2812 aa
MTSLNDIVNKLSSSKIKTRSDALQNLRSYIIYSRNGNSLNQEDALIIEKAIKRAFELEWQ
ISANHGKRQISKASQEQKLQDISYLLRTCVESYILLFREPHILALLDIILRHTFTANGSI
CEVVCLNFSKALRLLLSHSPHLHHLRFSDWQSLVSYCCQAIEKLSIAEETYVSDSEEEPI
SQKNYQEISIWKSHDVIRVKQEVVELIYVMRSLVQWYAAPINFVSEQLLKFFEFFFYAYT
EETDAHLPALQCLFQLCAYAIPNCNDYSASVVLLVFKILINSDKWKRLDLRLQLIQCLAI
SYPLWSNSETWDPHRSIRSFNLDLLNSSFFSLKNFLNFFGKRSSLSLANFRFHTVEPKNN
IAKLYDPRLHLFFSLRHNSFFESYFIYFFLAKLILLKKTVLSLASTEQANKKQKTCSQIE
ELLLQAELANISASSFSLQLMVIITAISDNLTNDDLLSIQKMSLNFTEKKNELQSWSFFI
LFNICYNKAYSSMLTTSCKKEILAAASRGLLNSVTSPVCYQILTYFNMYRPLCFASIFPF
IKQQFILFNDYSPMLSYEAIDYWKSLYILLNENLFVGQSSFKSVFLKWLKWHLYHLFSKE
GELPFFSFTDSSIIIFDLLMMIFYRPLSLSYITTEIRSPFERNLFHLKEAWSPVTLRFPY
TTDEICKQSTEGCYPFNSNHTIDCDSLQNVIKMLESSIDEISSASYDKDELDKETPSFEA
VMIFSQISFLCGFLNCFIQKKGIHNVTPNNLVIFKNLFPEVLSFVKSNHSYDPIINCIST
NLQFTISDEPKHLRYEIGSDLIRSTHFRDSNPLKTLVLYIMDMASKNVFIKPQEFDHDEY
FSQEEEDIYRPENLIRNHQILGLMEGSLEQIRNTDLFILQKYIDYFSSHPHDSLINILHL
YPIETFCFGMSAIGAYFLDVARTSEPIFYKCLEILAQKILMNYDYERDEVYLMIFIKIFQ
KCVHSKLQFTDATLKLIVKITKFIEKVFIETKFSSLSGRQTFLKFIFQLSPTSHVYSKFD
YQKLISLTLKDSDVCVIYNFVDDLVIFLKKCDKTLIEGFVLPILSIKIEKSLYKGFCYLY
LTLKVFLSISSNRSALLYQLLKLANSYETSTIFEPLLRKLHIQSANIKQLFRIYRLEIFW
SFVSKDLSNTTNDFLEFPYKPIYFSLSDFLKENSDEIILVLILTKNITLAKLITSRMSVD
FSEKYTQLIPVITTYTHLSEVENKKYSLRFNSIDEALDVELLNRSKAFLFCLEMLKEVKE
LGSTFKSISSTSFKVYSQLTIFANRVSFNNSTAIPFFSTKSVLWYCNRLFQELEGFSSIP
SVIDLVLRRLAIQLHFATDEELQVTISFRLCAFLCFSDPFITSNYLVMIVLRIARQLLSI
PCTQSLGLGIARFHLKKFKPTDFDYFFQLAEFCMDFLGFCYNTIGTKMEAIQDFYTWFDG
YVTALLNFEYEGYGFLRCQINFVRSVMTTKNEWIEVSNKLFERGHFLKRIAMNNYLCLYF
WQVLDACPRNVLHSLSLEIWKCYKAYDITEFPDSLKLFFSDIMGWNFFKSPEIADLNHYI
PKTDPRLCDTKTYEESKLIIWKLICQKACSLLFKYDILLDSFIEDCIRMFFENGNHQELR
KFLNFPKDSIIYDSDFKTLVSEEGSFQWVKLQPTNFDSLSNWTKEETLKLLNMMGKSSTT
HSLKLLSTYMVGFSTSIIQYIIHLILLEFDFNGNNKKQKEYVTQLILSGLLNKNTNSIRK
TCMNILLYLRRQLGHHALNPFEANYWVPINYSVAASTAYDCHLYEQSLLFLTIHNTKTDE
LDITLLSDILSQLPCPDAYYGIKRETSFKNILLKAVHEKRSPLAISYLDAANMYRSNEDE
GTKMMFSNTLNNAGFFSLNEFYIDSLKANDAIDECSNEVYASAWRMQKWDIPPLSLDNKT
TKDCLVFEVLHAVHNYAIYGNYLHLEEYINKKLLLINPNEEPDSLLFYALAYDLKFLIRC
NQSQFNCDILQLLKENKQMSSQLHECFQLLLEIRNVLLSLLQSHKQLDLSDDLASFRKYY
ILELLKISESFLIVDNLQNAFSVAMLSDALYRKFDLADENLKHDIDFLSSKILWQRDEKI
DAIGMLSESLSKTNSSIFPSISYAYLGNWLYTTKSEKTELVSKNYFEKSLSHMSHLNAKE
KAKIYCMFAQFCDNNYSSPDLTEDFKRMEKLYFEKKNDIQQLERSIVNASNMKEEKMLKN
HHSREMSSFIIDEREYLRMSTFRSKMLTQSITHYLKCLSESDENDVLISRCCTMWLSNSH
LDELNNSLQHYLQNLPCKKFIPVFYQLAARLMNENSKFQQSLTSICYNVGRNHPYHSLHV
LFSLVSNVPEIENLDAGSRYRAVKKILDLLKVNQGLSNLVTKLLCSFENYVSLAEWNPRS
KVDSTSFSRFPGYKWFLKDAANYGLPPITMNVKVNDTGDYSNIPTVSSFDDTIHFASGIN
APKVITCLGSNGHTYKQLVKGGNDDLRQDAVMEQVFEQVNGFLRSYRKTSQRNLSMRTYK
VIPLALKTGVIEWVQDTIPLGEYLDSAHKVYHPKEWSLSTCRKLIAEKQMEDLETRLKVY
DLVCRHYRPVFRHFFLESYADPVQWFTTQTNYARSTAVASVLGHVLGLGDRHGQNILIDK
TSGEVIHIDLGIAFEQGKKLPVPECVPFRLTRDVVDGMGITGVEGVFRRCMEFTLETLRR
EEDSLLSVLEVLRYDPLFSWLISPLRRMKKQKMQLENFNQPESGNITTDASRDPKIQRNN
VSGESEAERAILKVRQKLSSTLSVEASVGELIRIAQDPSYLALMFCGWSAFQ
NT seq 8439 nt   +upstreamnt  +downstreamnt
atgacttctctaaatgacatcgttaataagttgtcttcatcaaaaatcaaaacacgatca
gatgctctacaaaatcttcgcagctacataatttactccagaaatggaaattcgctaaat
caggaagatgctttaataatcgaaaaggccataaagcgagcattcgaacttgaatggcaa
atttctgctaatcatggtaaacgtcaaatttccaaagcttcccaagagcagaagcttcaa
gatattagctatttgttaagaacatgtgttgaatcttatattttattatttagggagcct
catattttagcgcttctagatataattctaagacatactttcacagctaatggttctata
tgtgaggtagtctgtttgaatttttctaaggctcttcggctactattatcccattctcct
catttgcatcatcttcgtttctcggattggcaatcactagtttcctattgttgtcaagct
attgaaaaactaagtatagctgaagaaacttatgttagtgatagtgaagaagagccaata
agccaaaaaaactatcaagaaatatctatctggaaatcgcacgatgttataagagtaaag
caagaagtcgttgagctcatttacgttatgcgttctcttgttcaatggtatgcggctcca
attaattttgttagtgagcaactgctgaaattttttgagttctttttttatgcttacacg
gaagaaacagatgcgcatctaccagctttgcagtgtttgtttcagttatgtgcatatgcg
atccccaattgtaatgattattccgcaagcgttgttttattagtctttaagattcttata
aactctgataaatggaagcgtctggatttaagattgcagcttatacaatgcttagccatt
tcttatccactttggtccaattcagaaacatgggatccccatcgttccattagatctttt
aatttagatcttcttaactcttcgtttttttctttaaaaaatttcttaaatttttttgga
aaacgctcctcattatcgcttgcgaattttagattccatacagttgagcctaagaacaac
attgcaaaactttacgatccacggctacacctttttttttctcttagacataattctttc
tttgaatcttactttatttatttttttcttgcaaaactaattctcctcaaaaaaaccgtg
ttgtccttagcaagcacggagcaagccaacaaaaagcagaaaacatgttctcaaatagag
gaactgcttttgcaagctgagctagccaatatctcggcttcctctttttcattgcaactc
atggtaattatcactgctatttctgacaatctaacaaacgatgatctattgtcaattcaa
aaaatgagtcttaactttactgagaaaaaaaatgaacttcaaagctggtctttttttata
ttgttcaacatttgttacaacaaagcttactcttcgatgcttacgacttcatgtaaaaag
gaaattttggctgctgcttctcgtggtctcctgaattctgttacgtctcctgtatgctat
caaattttaacttattttaacatgtatcggcctttgtgcttcgcgagcatttttcctttc
ataaagcaacagtttattttatttaatgattactcgccaatgctttcatatgaagccatt
gattactggaaatctctgtacatattacttaatgaaaacctatttgttggtcaaagctct
tttaaatctgtgtttctaaaatggttgaagtggcatctatatcatttgttcagcaaagag
ggtgaactaccatttttctcatttaccgattcttctattatcatttttgatttgttaatg
atgatcttctatagaccgttgtcattatcttatatcaccacagaaatacgatcacctttc
gaacgtaatttgtttcacctcaaagaagcatggtcgcctgttacgcttcgttttccttat
actactgacgaaatatgtaaacagtctacagaaggatgctatcctttcaatagtaaccat
actattgactgtgatagtttgcaaaatgtcattaaaatgttggagagctcgatagacgaa
attagctcagcatcttatgacaaagatgagcttgacaaggaaaccccaagcttcgaagca
gttatgatattttctcagatatcatttttatgtggctttctaaattgttttatccagaaa
aaaggtattcataatgttactcctaacaatcttgtcatttttaaaaatttattccctgaa
gtcctttctttcgttaagtctaatcacagttatgacccaataataaattgcatctctact
aatttgcagtttactatttctgatgagccaaaacatcttcggtatgaaattggaagcgac
ttaattcgttcaactcattttcgagacagtaatccgctcaaaaccttggttctttatata
atggatatggcttctaaaaacgtattcataaagcctcaagaatttgatcacgatgagtat
ttctcccaggaggaagaagatatttatcggccagaaaatttaatcaggaatcatcaaata
cttggtttgatggaaggatcgcttgagcaaatacggaatactgatctttttattttacaa
aaatatatcgactacttttctagtcatcctcatgacagcttaattaatattcttcatttg
tatcccattgaaactttttgttttggtatgtctgcaattggtgcatatttcctagatgtt
gcgcggacatccgaacctattttctacaaatgtcttgaaatactggctcaaaaaatttta
atgaattatgattatgaaagagacgaagtctatctaatgatttttattaaaatatttcaa
aaatgtgttcattctaaacttcagttcacggacgcaactttgaaacttattgtgaagatt
acaaaattcattgaaaaggtttttattgagactaaattttcatcattatctggtagacaa
acttttttaaaatttatatttcagttatcccctacatctcacgtttattcaaaattcgat
tatcaaaaattgatttctttaactcttaaagactctgatgtttgtgttatttataacttt
gttgacgatttggtgatttttcttaaaaaatgtgataaaacgttaattgaaggttttgtt
ctcccaattttaagcattaaaattgagaagtcattgtataaaggcttctgctatttatat
ttgactttaaaggtttttttgtcaataagttccaatcgatcagcattgttgtatcagctg
cttaagcttgcaaacagctatgaaacgtcaactatttttgaacctttgcttcgtaagctt
cacattcagagtgcaaatattaagcaactgtttcgaatatacaggttagagatattttgg
tcattcgtcagcaaagatctttctaatacaaccaatgactttctagaattcccctacaaa
ccaatttatttcagcctttccgattttttaaaagaaaacagcgacgaaattatacttgtt
cttattctgactaagaatataaccttggctaaactcattacttcacgcatgtctgttgat
ttttctgaaaagtatacgcaattgatccctgttataacaacttatactcatctaagtgaa
gtagagaataaaaagtattcgttgagatttaattctattgatgaagcacttgatgtggaa
ttactcaaccgctccaaagcttttttgttctgcttagagatgcttaaagaggttaaagaa
ttaggctctacttttaaatctataagctcaacttcgtttaaggtgtactcacaattaaca
atttttgccaatcgcgtctcttttaacaatagcacagcgataccattcttttctacaaaa
tctgtgttatggtattgcaatagactcttccaagaattagagggcttctcctctatccct
tcagtcattgatttagttttaaggagacttgcaatacaactacactttgcgacggatgaa
gaacttcaagttactatttcttttagattgtgtgcttttctatgtttctctgatcctttt
atcacttcaaactatttggtaatgatagtacttaggatagctagacaattactctcaata
ccttgtacccaatcactaggattaggaattgcgcgctttcatttgaaaaaattcaaacct
actgattttgattatttctttcaactagccgaattctgtatggactttttgggtttttgc
tacaacactattggtacgaagatggaggctatccaagatttttatacttggtttgatggt
tacgttactgctttactaaattttgagtatgaaggttatggatttttacgctgtcaaata
aactttgtacgttcagtgatgacaaccaaaaatgaatggatagaggtttcaaataaactg
ttcgaaagaggtcactttcttaagagaatcgcaatgaataattatctttgtctctacttt
tggcaagtcctcgatgcttgtcccagaaatgttttacactccttaagccttgaaatttgg
aaatgttacaaagcatacgatattactgaatttcctgactctttgaagctctttttttca
gacatcatgggctggaattttttcaaatctccggaaattgctgatctcaatcattatata
cccaaaaccgatcctcgattatgcgatactaaaacttatgaagaatcaaaacttattatt
tggaaattgatatgtcaaaaagcatgttctcttttatttaaatatgacattttattagat
tcattcattgaggattgcattaggatgttctttgaaaatggtaatcaccaagagcttaga
aaatttttaaattttccaaaagatagtatcatctacgatagtgatttcaagactcttgtt
tctgaggaaggttcttttcaatgggtaaaattacaacccacaaattttgattctttgtca
aattggactaaggaagagacgctgaaattattaaatatgatgggaaaatcatcaacaaca
cattctctaaaattgctgagtacttacatggtggggttttcaacttcaattattcaatat
attatacatttgattctgttggagtttgattttaatggtaacaacaaaaagcaaaaggag
tatgtaacacaactgatcttatctggtttgttaaataaaaatacaaatagtattcgaaag
acttgcatgaatattttattataccttcgtcggcaattagggcatcatgctcttaatcca
tttgaagcaaactactgggttcccattaattacagtgttgcagcatcaactgcttatgat
tgccatttgtatgaacagagtctacttttcttgacaatacataatacaaaaacagatgaa
ttggacatcacccttttatcggacattctttcccaactgccttgtccggatgcttattac
ggaataaaacgcgaaactagcttcaaaaatattttgctcaaggcggtgcatgaaaagcgg
agcccattagccatttcgtacctcgatgctgcaaatatgtatcgaagcaatgaagatgag
gggactaagatgatgttttcaaatactcttaataacgctggattctttagcttgaatgaa
ttttacatcgattcactcaaagccaatgatgctattgatgaatgcagcaacgaagtgtat
gcttctgcttggcggatgcaaaaatgggatatccctccactttctttggacaataagact
actaaggattgtttggtttttgaggtattacatgcagtgcataactacgctatttacggt
aattatttgcacctcgaagaatacattaacaaaaaattattactaattaatcccaacgag
gaacccgatagtctactattttatgctttggcttatgatttgaagtttttaatacgatgc
aatcagtctcagtttaattgtgatatccttcaattgcttaaggagaataagcaaatgtca
tcacagttacatgaatgttttcagttattacttgaaattagaaacgtcctactttccttg
ctacagtcacacaaacaactggacttgtctgacgatctagcctcatttcgcaagtactat
atcttggaactcttaaagattagcgagtcttttttaatagttgacaaccttcaaaatgca
ttttccgtggctatgttaagtgatgctctttatcgaaagtttgatttggcagatgaaaac
cttaagcacgatatagattttctttcatctaaaatcttatggcaacgtgatgaaaagatt
gatgccattggcatgctctccgaatcactttcaaaaacaaattcgtccatttttccatct
attagctatgcatatcttggaaactggttgtatacaacaaaatccgaaaagactgaatta
gtctcaaaaaattattttgagaaatccctttcccatatgtcacacttgaacgccaaagaa
aaagctaaaatttattgtatgtttgctcaattttgcgacaataattattctagcccggat
ctgactgaagatttcaagcgtatggaaaagctttattttgagaaaaagaatgatatccaa
cagttagagcgttccattgtaaatgcttctaatatgaaggaagaaaaaatgctaaaaaac
catcattctagggaaatgtcttcatttatcattgatgaacgcgaatatttaagaatgtca
acttttaggagtaaaatgctcactcaaagtataactcattatttgaaatgtttaagtgaa
agtgacgaaaacgatgttttgatatctagatgctgtactatgtggctttcaaattcacat
ttagatgaactgaacaattccttacagcactatttacaaaacttgccttgtaaaaagttt
atacctgtcttttatcaattggcagctcgtttgatgaacgagaactcgaaatttcaacaa
tcgttgacatctatatgctacaacgttggacgtaatcatccttatcactctttgcatgtt
ttgttttcgcttgtgtccaatgttccagaaattgaaaatctcgatgctggatcacggtat
agagcagttaaaaaaatccttgatctgttaaaagttaatcaaggattatccaatttagtc
accaaacttttgtgctcctttgaaaactatgtaagtttagcagagtggaatcccaggagc
aaagttgacagtacatcttttagtcgatttcctggatataaatggtttctaaaagatgca
gcaaactatggattacctcctataacaatgaacgtaaaggtaaatgatacaggtgattat
tcaaacatccctaccgtttcttcattcgatgataccattcattttgcctcagggattaat
gcgccaaaagttattacatgtttgggctcaaatggtcacacatataaacagttggttaaa
ggggggaatgatgatcttcgtcaagatgctgttatggaacaggtgtttgagcaagtaaac
ggatttctcaggagctatcgaaaaaccagtcaaagaaatctgtcaatgcgtacttataag
gtgattccattagcattaaagacaggtgtcatagagtgggttcaagataccattcccttg
ggtgagtatctggattcggctcacaaggtttaccatcctaaggaatggtctttgagtact
tgtcgaaaattaatagctgagaaacaaatggaggatttggaaactagattgaaagtttac
gatttagtttgtagacattatcgtcctgtctttcgccattttttcctcgagagttacgct
gatccagtgcaatggtttacaacgcaaacaaattacgcacgaagcactgctgttgcttct
gtcctgggacatgttttgggacttggagatagacatgggcaaaatattttaatagacaaa
acgagtggagaagtgattcacattgatctaggaattgctttcgaacaaggtaaaaaacta
cccgttcctgaatgtgttccctttcgacttacaagagacgttgtagatggtatgggaatt
accggggttgaaggggtatttcgaagatgcatggagtttacattagaaacacttcgacgg
gaagaggattcactactgtctgtcctggaagttttaagatatgatccattattttcttgg
cttatttcacctttgagaaggatgaaaaaacaaaagatgcaacttgaaaactttaatcaa
ccagagagcgggaatattacaacggatgcttctagagaccccaagatacaaaggaataat
gtatcgggagaatcggaagccgaaagagctatacttaaagtaagacagaaattatcaagt
actctttcagtagaagcttctgtgggagaattgattcgaattgctcaagatccctcatat
ctcgcacttatgttttgtggatggtctgcctttcaatga

DBGET integrated database retrieval system