KEGG   Schizosaccharomyces pombe (fission yeast): SPCC23B6.05c
Entry
SPCC23B6.05c      CDS       T00076                                 
Symbol
ssb3
Name
(RefSeq) DNA replication factor A subunit Ssb3
  KO
K10740  replication factor A3
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03030  DNA replication
spo03420  Nucleotide excision repair
spo03430  Mismatch repair
spo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SPCC23B6.05c (ssb3)
   03420 Nucleotide excision repair
    SPCC23B6.05c (ssb3)
   03430 Mismatch repair
    SPCC23B6.05c (ssb3)
   03440 Homologous recombination
    SPCC23B6.05c (ssb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spo03032]
    SPCC23B6.05c (ssb3)
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC23B6.05c (ssb3)
DNA replication proteins [BR:spo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    SPCC23B6.05c (ssb3)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     SPCC23B6.05c (ssb3)
   MMR (mismatch excision repair)
     SPCC23B6.05c (ssb3)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     SPCC23B6.05c (ssb3)
SSDB
Motif
Pfam: Rep_fac-A_3 ILEI
Other DBs
NCBI-GeneID: 2538775
NCBI-ProteinID: NP_588128
PomBase: SPCC23B6.05c
UniProt: Q92374
Position
III:complement(<1281886..1282392)
AA seq 104 aa
MERPTPRVTKDMLPECSGKTVRIVGKANQVEGETAKVDSNGSFDMHLTVDNTLEPNHFYE
FVVSVKPDSSVQLLTCVDFGTDIDMEVYQKLVLFSHKYNSLFFE
NT seq 315 nt   +upstreamnt  +downstreamnt
atggaacgccctacacctcgagttacgaaagatatgctaccagaatgctctggaaaaacg
gttcggattgttggcaaggcgaatcaagttgaaggtgaaactgcaaaagtcgattccaac
ggttctttcgatatgcacctcactgtggataacactcttgaacccaatcatttctatgaa
tttgtcgtttctgtcaaaccagattcttcggtgcagcttttaacctgtgttgattttggc
actgatattgatatggaggtataccagaaactcgttctattcagtcataagtataactca
cttttttttgaataa

DBGET integrated database retrieval system