KEGG   Schizosaccharomyces pombe (fission yeast): SPCC24B10.12
Entry
SPCC24B10.12      CDS       T00076                                 

Gene name
cgi121
Definition
(RefSeq) putative EKC/KEOPS complex subunit Cgi121
  KO
K15901  EKC/KEOPS complex subunit CGI121/TPRKB
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spo03016]
    SPCC24B10.12 (cgi121)
Transfer RNA biogenesis [BR:spo03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    SPCC24B10.12 (cgi121)
SSDB
Motif
Pfam: CGI-121 DUF2656
Other DBs
NCBI-GeneID: 2539388
NCBI-ProteinID: NP_588015
PomBase: SPCC24B10.12
UniProt: Q9P7J3
Position
III:921422..921946
AA seq 174 aa
MILPLFPETQVHVFVYENVSNCAAIHEQLISQNPIYDYAFLDAATILYKKQVYSAIIRAL
EDRRDEQMKTKTIHSEVILSLSPKTEISSAFRQFSMTKKSKNIVVVKIDSKLTEEEEFER
LDKLVEGNRVEFSDEELQKLIDFKVLKKNYKLDPSTLENPLASILSSIALRGYS
NT seq 525 nt   +upstreamnt  +downstreamnt
atgattttacctctttttccagagacacaagttcatgtttttgtatatgaaaatgtttct
aactgtgctgcgattcatgaacaactaataagccagaatcccatttatgactatgcgttt
ctcgatgccgctactattctatataaaaagcaggtttatagcgctattattagggctctc
gaagatagaagggacgaacaaatgaaaactaagacgattcactcagaggttattttgtca
ttgtccccaaaaaccgaaatttctagtgcgttccgacaattcagcatgacaaaaaaatct
aaaaacattgtagtggtaaaaattgatagcaaacttacagaagaagaagaatttgagcgc
ttggacaaacttgtggaaggtaatagggtcgaattttctgacgaagagttacaaaaatta
atagacttcaaggtgttaaaaaagaattacaaattggatccctctacgcttgagaatcct
ttggcctctatattatcttcgatagctctacgtggttattcttaa

DBGET integrated database retrieval system