KEGG   Schizosaccharomyces pombe (fission yeast): SPCC24B10.17
Entry
SPCC24B10.17      CDS       T00076                                 

Gene name
emp24
Definition
(RefSeq) putative COPII-coated vesicle-associated protein Emp24
  KO
K20347  p24 family protein beta-1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPCC24B10.17 (emp24)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    SPCC24B10.17 (emp24)
SSDB
Motif
Pfam: EMP24_GP25L
Other DBs
NCBI-GeneID: 2539350
NCBI-ProteinID: NP_588020
PomBase: SPCC24B10.17
UniProt: Q9P7I9
Position
III:join(930591..930684,930751..930947,931078..931386)
AA seq 199 aa
MAFFNVFKAVLCAYFISVVFGHGITLKPHQRECFYENLRNNDQMSVTYQTNVGGDQLVSM
SIYNPAGQIMHQEVPNSMAQYSFTVKNPGKYMYCFYNDALDGESKEVLFNVHGVIYISDE
DLDANNPLLGKVRQLHDTISKVKHEQEYFVARERIHRNTAESTNDRVKWWSILQTVILVS
VCVFQIFYLKRLFEVKRVV
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcgttttttaacgtatttaaagccgtgttatgtgcttattttatatctgttgttttc
ggtcatggcattacattgaaaccgcatcaacgagaatgtttctatgaaaatttgaggaat
aatgatcaaatgtctgtcacttatcaaacaaacgttggtggtgatcagcttgtttctatg
agtatctacaatcctgcgggtcaaattatgcatcaagaggttcccaactctatggcccaa
tattctttcaccgttaagaacccagggaaatacatgtattgtttctataatgatgcactc
gatggtgaatcaaaggaggttttattcaatgtgcatggtgttatatatatctctgatgaa
gatttggatgctaacaatcctttactcggcaaggtccgccaactccatgataccatctcc
aaggtaaaacatgagcaggagtattttgtggctcgtgaaagaatacatcgcaatactgct
gaaagcacaaatgaccgcgtcaagtggtggagtattcttcaaaccgttattctagtttcc
gtatgtgtattccaaattttctacttaaagcgacttttcgaagtaaagcgtgttgtatag

DBGET integrated database retrieval system