KEGG   Schizosaccharomyces pombe (fission yeast): SPCC285.03Help
Entry
SPCC285.03        CDS       T00076                                 

Definition
(RefSeq) putative ATP-dependent RNA helicase Dbp6
  KO
K14807  ATP-dependent RNA helicase DDX51/DBP6 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPCC285.03
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPCC285.03
Ribosome biogenesis [BR:spo03009]
 Eukaryotic Type
  Pre-60S particles
   Helicases
    SPCC285.03
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII SNF2_N F-actin_cap_A AAA_19 Gemini_AL1_M
Motif
Other DBs
NCBI-GeneID: 2538809
NCBI-ProteinID: NP_588332
PomBase: SPCC285.03
UniProt: Q76PD3
Position
III:1797992..1799806
Genome map
AA seq 604 aa AA seqDB search
MSVEVDKSSHSKPKIEKKSKRNKRKWLNDENKTHVTASEAAIERLKKSASFSQAAQQALK
QSRKEDNERDIEMQDVDAEAQPHDLLPIPQPSVEDFVDSKPHVKNITSVLPKWLAEPITV
DPNTTVEFSSLNISSKLVERLQKQNITRGFAVQAAVLPLLLQDGRHGPMYSYGGDVCVSA
ATGSGKTLSYVIPIVQCLSHRTVPRLRCVVIVPTRELTVQVAKTFEYYMSGAGLQVCAWT
GQKSLRHETYQLNGDENECRIDVLVSTPGRLVDHIRNDESFSLQHLRYMVIDEADRLLDQ
SFQDWVDTVMMEISHPKCLQNKSNILDLDQNISPTFLPDIDTLLPYRLPSPLQKLVFSAT
LTRDPSKIASLKLHNPRLVLVQNKDMEVDDGGEIEDDAIVFSVPPTLQEYHVSVSSEKPI
LLYHLIHSKNLTNILCFVKSNEAAARLHRLLELIHESLNQSFSCGLFTSSLSRDERKKII
SRFATGDLNLLVCSDLMARGIDVANTQNVINYDPPLSVRSYVHRIGRTARAGREGFAWTL
VQSHEGHHFSKLVKQLRRTLPIKRIKIEFSHISEEFVVAYDKALEALRVEVFNSRYPQQK
SFLT
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgaagtagataaatcttctcattcgaagcctaaaattgaaaaaaagagcaag
agaaataaaagaaaatggcttaatgacgagaataagactcatgttactgcttctgaggct
gccattgagagattgaagaaatccgctagcttttcacaagctgcacaacaagctttaaag
caatcgagaaaggaagacaatgagcgagatatagaaatgcaggatgttgatgctgaagct
caacctcatgatttgttaccaattccacaaccatcagttgaagactttgtagattcaaaa
ccgcatgttaaaaatatcacctctgtcttgcctaaatggctagctgagcccataactgtc
gatcctaatacaactgtggaattctcgtctttaaatatatctagtaaacttgtcgagcga
cttcaaaaacagaacatcacccgtggatttgctgttcaggctgctgtattaccgttactc
ttacaagatggaagacacggtccgatgtatagttatggtggagatgtttgtgtaagtgca
gctactggcagtggtaaaactctttcgtatgtgattcccatcgtccaatgtcttagtcac
cgtacagtacctcgtttgcgttgtgtggttattgttcccacacgagaattgacagtccag
gttgctaaaacctttgagtattatatgtctggtgccggtttacaagtttgtgcctggact
ggtcaaaaaagtttacgacatgaaacatatcaactaaatggtgatgagaacgaatgtcgt
attgatgtgttggtgagcactccaggtcgattagttgaccatatccgaaatgacgaaagt
ttctctttgcaacatttgcgttacatggtaattgatgaagctgaccggttgctcgatcaa
agctttcaggactgggtggatactgtgatgatggaaatatctcatcctaaatgtcttcag
aataaatcaaatatcttggatttagatcaaaatatttctcccacatttttacctgatatt
gacacacttttaccatatcgtttaccttctcctttacaaaaacttgtattttcagcaacg
ttaactagagacccttcaaaaattgcatctcttaaacttcataatccacgtttggtcctc
gttcaaaataaagatatggaggttgatgatggtggagaaattgaggacgatgcaattgta
tttagtgttcctcctactttgcaagaataccacgtctctgtcagttcagaaaaacctata
ctactttaccatttaatacactcaaaaaatttgactaatattctttgttttgtcaagtcc
aatgaggcagcagctcgattacaccgtttactggaattaattcatgaatccttgaatcaa
agtttctcctgtgggttatttacctcatctttatcaagggatgagagaaaaaaaattatc
agtaggtttgcaactggcgatttgaatttgttggtgtgctcagacctgatggcgcgtggt
attgacgttgctaatactcaaaatgtgattaattatgaccccccgttaagcgttcgtagc
tacgttcacagaattggacgtactgctcgtgctgggcgtgaaggttttgcatggacactt
gttcaaagtcatgaggggcatcatttttcgaagctggttaagcaacttagaagaacctta
cccataaaacgtataaagattgagttttctcatatttcggaagagtttgtagtcgcatat
gacaaggcgcttgaggcccttcgtgtggaagtattcaattcacgttatccacaacaaaag
tcctttttaacttaa

DBGET integrated database retrieval system