KEGG   Schizosaccharomyces pombe (fission yeast): SPCC285.09c
Entry
SPCC285.09c       CDS       T00076                                 

Gene name
cgs2
Definition
(RefSeq) cAMP-specific phosphodiesterase Cgs2
  KO
K01120  3',5'-cyclic-nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPCC285.09c (cgs2)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     SPCC285.09c (cgs2)
SSDB
Motif
Pfam: PDEase_II Lactamase_B_2 Lactamase_B GCSF
Other DBs
NCBI-GeneID: 2539207
NCBI-ProteinID: NP_588337
PomBase: SPCC285.09c
UniProt: P36599
Position
III:complement(join(1811032..1811560,1812013..1812425,1812472..1812480,1812542..1812631))
AA seq 346 aa
MHAALEIKEAEFQTDQVVGLVENSFTLYSLGQNGGPLESCCSSHLISDGAFQEIISLDGG
SHLSALVELIQSKHLSVDSWSSITKYDNYTVENESYAKAWHLSEQRIKTFLITHCHLDHI
YGAVINSAMFGPQNPRTIVGLNYVIDTLKKHVFNNLLWPSLDKAGFINFQVVEPSMYTSL
TTTLSILPFPVNHGSSFGQELKSSAFLFRNNLSDRYFLAFGDVEPDMVASEPLNIHIWRA
CSSLIAQRKLSHILIECSTPDIPDTLLFGHFCPRHLVNELCILQSLVQSYGVIMPTLTCL
LTHLKSHPLQSANPADVILEQLESLSSKSSLSVTFKILQRGQFYKF
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgcatgcagcactcgaaatcaaagaagctgaatttcaaaccgatcaagtagtaggactc
gtagaaaattcttttacattatattcattgggacaaaatgggggtccattggagtcttgc
tgtagcagtcatttgatttctgatggcgcatttcaagaaattatatcgctggatggtgga
agccacctatcggcgttggttgagttgatccagtcaaaacacctgtccgtcgattcttgg
tcttccatcaccaagtatgacaattatacggtggaaaatgaatcatacgcaaaagcctgg
cacctttcagagcaaaggattaaaacgtttctcatcacacactgtcatttagaccacatc
tatggagccgtcatcaatagcgccatgtttggtcctcaaaatcctagaaccatagttggg
ttaaactatgtgatcgataccctaaaaaagcacgtgtttaataacttattatggccttcc
ctcgacaaagccggatttattaattttcaggtggttgagccttccatgtatactagttta
acgactactttgtctatattgccctttcccgttaatcatggctcctctttcggtcaagag
ctaaagtcgtctgcatttttatttaggaataacctatccgacagatactttttggctttc
ggggacgtcgaacccgatatggtagcctcagaaccgcttaacattcatatttggagagct
tgctctagtttaattgctcaaagaaagctttctcatattcttatcgaatgctccactcct
gacatccctgatactcttttgtttggtcatttttgccctagacatctagtgaacgagctt
tgtatactccaatctctggtccagagttatggcgttatcatgcctacccttacgtgtttg
ctcactcatttgaaatcacatcctcttcagtcggcgaatcctgccgatgttatattggag
cagttagagtcgttgtcttccaaaagttctctttcagtcacatttaaaatccttcagcgt
ggtcaattttataaattttaa

DBGET integrated database retrieval system