KEGG   Schizosaccharomyces pombe (fission yeast): SPCC285.16c
Entry
SPCC285.16c       CDS       T00076                                 
Symbol
msh6
Name
(RefSeq) DNA mismatch repair protein
  KO
K08737  DNA mismatch repair protein MSH6
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SPCC285.16c (msh6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC285.16c (msh6)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     SPCC285.16c (msh6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_II MutS_IV AAA_14 AAA_23 AAA_27 Shugoshin_C AAA_29
Other DBs
NCBI-GeneID: 2539215
NCBI-ProteinID: NP_588344
PomBase: SPCC285.16c
Ensembl: SPCC285.16c
UniProt: O74502
Position
III:complement(1827452..1831715)
AA seq 1254 aa
MSVGNVGKQREKTKDSSAKTKQKTLFGFFSKIPNVKQEKSDSTLSSSSNHDSNHDTPADV
DNSSNVNKNSSSPERELPTSPSHHANTEIDSSSSMLPPPSSDPFSSPLSSSLHRSSPKRP
HDSLGEESPGKLLRTSVKQEPDSEEEIDSPTKKKSFKSLDTSIFQAEDQFRHPVSSKLEN
SELSEVDKPFIASRRSRKPVSYAESDEDEDFDDAPTKGSRHKRIVSDDESDDYVEPDHIS
EASSEASLPIDEVESMDEDVDGYSDHSVSVAAPIPKKESRKESSNSLYESYRLGSQIASP
SPSVSGSASPTKSNKNGVLNREEKRRQRMEAFKKENNERYEWLLDVRDADQNRVGDPNYD
PRTLYIPPSAWATFKPFEKQFWKIKKDLMDTVVFFQKGKFYELYENDAAIGHQVFSLKLT
DRVNMKMVGIPEASFDYWASQFIAKGYRIARVDQLETALGKEIKDRQRTQKEEKVVQRGL
TQVLTSGTLVDEAMLTSDLSTYCMAIKESLQSDNEEPSFGICFIDTSTGGFHMCEFTDDI
HRTKLDTLLTQVRPKELILEKSKISQKSIRAIKYCVSSSSIWNFIKPYTEFWDNERVERE
IIAGDYFKNGLEGAPKILKSYLSEKPLAISAFGALFWYLRQLKLDKDMCSMGNFDEYDAS
QQSTSLLMNGQTLKNLEIFSNSFDGGSEGTLFHLLCRCVTPFGKRLFHTWLCHPLRSGTA
INARLDVVELIADNPVIRDTIWGFLHKLPDLERLISRVHAGRSKPADFVRVLEGFQRINS
AFDQLREEFMEVAEGTLLGEIIQSAPNMKEELEAWTRAFNWQKASEEGVFEPEIGFEAEY
DTSQKYQSELKNELYALLEQYKKQLRCSSLNFKNIGKEVYQVEVPSDVKVPVNWCKMSGT
KKTNRYYNDELRKKIKKLLEAEELHLAIMSRMQEKFYIRFDSNYEQWLALIKYTASIDCF
FSLSQAAAALGEPYCRPEIIEQKDGHLYFEELRHPCINASAASTFVPNDVVLGGESPNMI
VLTGPNMAGKSTLLRQVCIAVIMAQLGCWVPAKRASITPMTSIYTRLGANDDIMSARSTF
MVELSETKKILDECGPKSLVILDELGRGTSTYDGHAIAYAVLHHLVSNIGCLGFFSTHYQ
SLCVDFMHHRQVRLMQMAAAVDEKIRRVTFLYKLEDGICPKSYGMNVASMAGLPEKVIDA
AEEKASELEQASASFINASDDIALMSDFLQVLRISKSIEPLTAVNIPLILDSFE
NT seq 3765 nt   +upstreamnt  +downstreamnt
atgagcgttgggaacgttggcaagcaaagggagaaaacaaaagattcatcagctaaaaca
aagcagaaaaccctctttgggtttttctccaaaatcccgaatgtgaaacaagagaagtcg
gattctacattatctagtagttcgaatcacgactctaatcatgatacgcctgctgatgtt
gacaacagctccaatgtgaacaaaaactcttcgtctccggaacgcgaattgccaacgagt
ccttctcatcatgcgaataccgagatagattccagttcatctatgcttcctcctccatca
agtgatccattttcctcaccgctttctagcagcctacaccgatcatctcctaaacgccct
catgattctttgggcgaggagtcaccaggtaaattgcttcgcacgtctgtgaagcaagag
cccgactctgaagaagaaatcgattctccgacgaaaaagaaaagttttaaaagtttggat
acatcaatatttcaagctgaagatcaatttcgtcatcctgtctcgtcgaagctggaaaat
tcggaattatctgaagtcgacaagccttttatagcttctcggcgttcaaggaagcctgtt
tcctacgctgaaagtgatgaagacgaagacttcgacgatgcacctaccaaaggatctcgt
cataaaagaatcgtttctgatgacgaatcggatgactacgttgagcccgatcatatttcg
gaagcctcatctgaggcatccttgcctattgatgaagtcgaatctatggatgaggatgtt
gatggatattcagatcattccgtttctgtggctgctccaattcccaaaaaggaatctcga
aaggagagttccaattctttgtatgaaagttatcggctaggctctcaaattgccagtcca
agcccttcggtctcgggttctgcatctcccacaaaatcgaataaaaacggtgtcctgaac
agagaagaaaaaagaaggcaaagaatggaggcatttaaaaaagaaaacaacgaacgttac
gagtggttgctagatgttcgagatgctgatcaaaatcgagtgggtgatcctaattatgat
ccgcgcacattgtatatcccaccttcagcttgggcaactttcaagccatttgagaaacaa
ttttggaaaattaaaaaggaccttatggatacagttgttttttttcagaagggaaaattt
tatgagttatatgagaatgatgccgctatcggacatcaggtattttccttaaagttaact
gatagagttaatatgaagatggttggaattcctgaagcaagttttgattactgggcatct
caattcattgcaaaggggtatcgtatagctcgagtcgaccaattggaaaccgctttaggt
aaagaaataaaagatcgtcaacgaactcagaaggaagaaaaagtagttcagcgaggcctt
acccaagtcttaacgagcgggacccttgttgacgaggcaatgctgacttctgacttgtca
acatattgtatggctattaaagaaagtcttcaatctgacaacgaagagccttcttttggt
atctgcttcattgatacctcgactggtggttttcatatgtgtgaattcactgatgatatc
cacagaactaagcttgacactttattaacgcaagttcgccctaaggaactcatccttgag
aaatcaaaaatttctcaaaaatcgattagagcgataaaatactgtgtgtcttcatcttca
atctggaattttatcaagccgtatacggaattttgggataacgaacgagtcgagagagaa
attatagcaggagactatttcaaaaatggtttagaaggtgctccaaagatactaaagtcg
tatcttagtgaaaagcctctagccatcagtgcatttggtgctttattttggtatttacga
caattaaagttggataaggacatgtgttccatgggtaattttgacgaatatgacgcttct
cagcagtcaacttccctacttatgaatgggcagactttaaaaaatttagaaatattctct
aactcttttgatggtggatcggaaggcactttgtttcatttgctctgcagatgtgtcacc
ccttttggtaaacgtttatttcatacatggctttgtcatcctctaaggtccggtactgca
ataaatgcacgacttgatgttgttgagttaatagccgacaaccctgttattcgagatacc
atttgggggtttctacataaacttcctgacttggaacggttgatatcacgggtgcatgcc
ggaagaagtaaacccgcagattttgttcgagtattagaaggattccaacgaataaatagt
gcatttgatcagcttcgcgaggaattcatggaagtcgctgaaggaactttactaggagag
ataattcaaagtgcacctaacatgaaagaggaattagaagcatggacccgagctttcaat
tggcaaaaggcttcagaagaaggtgttttcgaaccagagattggctttgaagccgaatat
gatacttctcaaaaataccagtccgaacttaaaaacgaattgtatgcgcttttagagcaa
tacaagaagcagctaaggtgctcgtctcttaattttaaaaatattggtaaagaggtttat
caggtcgaagtcccaagcgatgttaaagtaccggttaattggtgcaaaatgtcaggtacc
aaaaaaaccaatcgatactataatgatgaactacgaaagaaaataaagaaattactagag
gcggaagagcttcatttagcaattatgtcgcgaatgcaggagaaattttatattcgattc
gattctaattatgagcaatggttggctttaattaaatatactgcatctattgattgcttt
ttcagccttagtcaagcagccgcagcgttgggtgagccatattgtagaccggaaattatt
gaacagaaggacggacacttgtattttgaggagttgagacatccttgtataaacgcaagt
gcggcttcaactttcgttcctaatgatgtcgttttaggaggtgaatccccaaacatgatt
gttttgaccggtccaaacatggctggaaagtccacattattgcgtcaagtctgtattgct
gttataatggctcaactagggtgctgggttccggctaaacgtgctagtataacacctatg
accagcatttacactagattaggtgccaatgatgatataatgtcggcacgaagtactttt
atggttgaactttcggagacaaagaaaattttggacgaatgtggacctaaaagtttggta
attttagatgaactaggtcgtggaactagtacttatgatggtcacgcgatagcttacgct
gtacttcatcatttggtttctaatattgggtgtttgggatttttttctacacattatcaa
agtctttgcgttgattttatgcatcatcgacaagtacgattgatgcagatggctgcagct
gttgatgaaaaaatcagacgtgtaacgtttttgtataagctggaagatggtatttgccct
aagtcttacggtatgaatgttgctagtatggccggcttacctgagaaggtaattgatgcg
gccgaagagaaggcctcggaacttgagcaagcgtctgccagcttcattaacgcaagcgat
gacattgctttaatgagtgatttccttcaagtgttgcgcatatcaaagtcaattgaacct
ttgacagcagtgaatatacctctcatacttgattcgtttgaataa

DBGET integrated database retrieval system