KEGG   Schizosaccharomyces pombe (fission yeast): SPCC290.04
Entry
SPCC290.04        CDS       T00076                                 

Gene name
ams2
Definition
(RefSeq) GATA-type transcription factor Ams2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: GATA DUF2321
Other DBs
NCBI-GeneID: 2539242
NCBI-ProteinID: NP_588400
PomBase: SPCC290.04
UniProt: Q9URT4
Position
III:join(2001292..2001331,2001429..2003482)
AA seq 697 aa
MMEKSLNTVTSLPLRVIYCIDRASAIRCLAKSQHAVPIQVLKEVEPKKVICQVDIQHVIQ
TVCRCSPELSCKSQGDFSVYFLDHTEPDELFVGLGYWSSLLLSPTLNAGTSNSDTVWVNG
FIVEFGIQRSIEIKLRFQSLQNSFEVGTPETHTSSKFLSSTLPPSLIFDPSSSEKSDSIS
GSLFDTNYTCPVNINGLSKQKSVRELKSPSRPSALAETNVEELELDSLFHASNDISCSAT
SFSEPYILDHQAALDHPATDPVCSASSTTVNSAVSTKKRRRESSTISPESAYVAAQLQNP
SEREQVHEFIKEQVRIARGRIEKKFTNVRGKNRIEEQLTLSLQEGKIPPYCQNCGTIKTA
NWRNATYMNITLMLCNACGIYWTSRRSMRPRNLWSTYKAFETEKPLENDAFAQLELAVYK
LSQQRKLSISIFRELENAGRHSPLNRLTSLDSTHSAPDPNHISKPSVVNQQKSRGGPRTA
KLKNDLRRIQSSPIVAPTPDTSFREPLSEIGSNDSWLVLPNSLSANIQNDVLRKTDFMCT
DKENVAFPLKTTTKPMPKVNKEETEPTLPVCDSEKENDDLECYFRTPPKPTTLQKQQQSP
SPWRSELFLSDPDQNVLTPRHKPKFDLSKALSSVAKSNNIENSPQLPERYDFSLELGLNS
QLDNEERRDIPLMTDLVMPSSPPMVPADRHLSVENTC
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatggaaaagtctctgaacacggtaacgtctttacctcttcgtgttatttattgtatt
gatcgcgcatccgcgattcgctgtttagcaaagtctcaacatgctgtgcccattcaggtg
ctgaaggaagtggaaccgaaaaaagtgatttgccaggtagacattcagcatgttatacaa
acagtttgccgctgtagtcctgaattgagttgcaaatcacaaggtgattttagcgtgtat
tttttagaccatacggaaccagatgaactcttcgtcggactaggctattggtcttctttg
ttgttatctcctactcttaatgctggcacgtcaaattccgacacagtttgggtgaatggg
tttattgtagagttcggtattcaacggtccatagaaatcaagttgagattccaatccttg
cagaactccttcgaggttggaactccagaaacacatacgtcttctaaatttttatcttcc
actttacctccatctcttatatttgatccatcatcttccgaaaaatccgattctatttct
ggatctttgtttgatacgaactatacatgtcctgtcaacataaacggtctttccaaacaa
aagtctgtccgcgaattaaaatctccttcacgtccctccgcattagctgaaacaaatgtt
gaagagcttgagttagattctttgttccatgcgtcaaatgacatttcatgctctgcaact
tctttctctgagccatacatactcgatcatcaagcggcgcttgaccatcctgctactgac
cctgtatgttctgcgtcgtctactactgtaaattctgcagtaagcacaaaaaaacgccga
cgtgaaagtagcaccatttcgccagagtcggcttatgttgcagctcagctacaaaatcca
tctgaacgtgaacaagttcatgaatttattaaagaacaagttcgaatagctcgtgggcgc
attgagaaaaagtttaccaatgtacgtgggaagaatcgaattgaagaacaacttaccttg
agcttgcaagaagggaaaattccaccatattgtcaaaactgtggaaccatcaaaactgcc
aattggcgcaatgctacgtacatgaacataactttgatgctttgtaatgcatgtggtata
tattggacgagtcggcgctcgatgcgtccaagaaatttatggtctacctataaagcattt
gaaacagagaaaccgttggaaaatgatgcatttgctcagcttgagttagccgtatataaa
ctttcccagcaacgaaaactatctatatccatcttccgtgagcttgaaaatgcaggacgg
cactctcctctgaatagacttacgtctttagactcaacacactctgcacctgatcccaat
catatctcaaaaccctctgttgttaatcagcagaaatccagaggaggtccccgtactgct
aagctgaaaaatgacctcagacgcatacaatcatctcccattgttgcacctactcctgat
acatcatttcgtgagcctttatccgaaattgggtctaatgatagttggctggtattacca
aattcactaagtgccaatatacaaaatgatgttttaagaaaaactgatttcatgtgtact
gacaaggaaaacgtcgcttttcctttgaaaaccacaacaaagcctatgcctaaagtaaat
aaagaagagacagagccaactctgcctgtttgcgattcagaaaaagaaaatgatgattta
gagtgctatttcagaacccctccaaaaccaactaccttacaaaagcaacaacaaagtcca
tcaccctggaggtcagagttatttttgtctgaccctgaccaaaacgtattgacaccaagg
cataagccaaagtttgatttatcaaaggcattgtcttcggttgcaaaatccaataacatt
gagaattcacctcaattaccagaaagatatgatttttctttagaattggggttgaattct
caactcgataatgaagaaagacgcgatattcctctgatgacagatttggtgatgccaagt
agtccgcccatggtccctgctgacaggcatttatccgttgaaaacacttgttga

DBGET integrated database retrieval system