KEGG   Schizosaccharomyces pombe (fission yeast): SPCC297.05
Entry
SPCC297.05        CDS       T00076                                 

Definition
(RefSeq) putative diacylglycerol-binding protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: DENN uDENN dDENN SPA FtrD-like
Other DBs
NCBI-GeneID: 2539220
NCBI-ProteinID: NP_588362
PomBase: SPCC297.05
UniProt: Q9Y7Q7
Position
III:1882768..1885689
AA seq 973 aa
MESIADHFFLAGLSNGFVSVSNSQFRADRLDEDAISVSSSIIQNNTRKSPLKRVSITSES
SFYKENTFAHHNTTGSNSVGPKKPFLDYHHSTSNTPTKKKKDSFDHASVTSLHRRSLSSN
TSTPRKYHSRKPYSEPSVIDKEHLQNRVSIGTTHTQNDLYQSYVAYPDALPLFAATHPFE
RRYPPSLLHQFPSSKDIKNETPTIDRCDFPNYVPMFAFPNDITIKESDVRPVSTYHSFAL
TSDNNSHLYGICVVVWVAMPQSMQNDLEKECEVWRANNTTVEDREVAEKLLSSLETERSK
LSSLLLKMQEKELEGSDSIDPILLEKIDVCEENIILYTELLRPMRYKLPRFVHGLTNNRT
LWIPNAYGLLSKHSHLQSFCRDWLRIVCSSIQAEDLDFIPSSDLNSLKSLNLQSFVKNIC
CDVPLPPKGLLQLQVNVGPLNLYAFRSPVNEIPGWNDVDLYPLFRALSIPNILVLFEAAL
MEAKVIFLSENLGMLGYASQALLHLLYPLTWQGLYIPVLPRRLISCFEAPCSYIIGTLSY
FFHMDDVPLDNIPLVVCDLDKNSVSTFGKIVRLSRSLRSKLQAHLKLAAPLHDKFYVPHS
PPKYTMETYPNNVLSLSTVTCFPLREKFSIPALLSFRSSNFSKRPYVLSPILNGFLKLQD
NPSSIYFAKQTDSRQSSASKLLYARLQAPEHARNFSSPPFTRPASPSSSKFRFSSSSFQS
TIRRNSLTSPYSVPELRSSESNQNKAGSINTGSAVNLVSSKPGEQKVHIMYKEGHKLRRI
YKMFPADSAGSICAVSGYALGDVHVQCDNCGLRVNLDFIKHISMPCVPACFNSQQILVTF
LKFFIKILGSYRNYLRKPHMSRENFGISKGSGGLIGSFDFNKFTRQASKVHGSWISSLCS
SQAFAEFIGDRCELDLNDPRVALFDQLLLCERNHGKPRLFGKATPFLRDKSLEIQRIEVA
PIPASLKNDNALH
NT seq 2922 nt   +upstreamnt  +downstreamnt
atggaaagtatcgcagatcatttctttctcgcaggtctctctaacggatttgtgagtgta
tccaattctcaatttcgagcagatagacttgatgaagacgccatatctgtttctagttct
atcatccaaaacaatacaaggaagtcgccattaaaaagagtgtcaatcacttctgagtct
tctttttataaagaaaatacctttgcgcatcacaacaccactggatccaattctgtgggt
ccaaagaagccgtttttagattatcatcactcaacatctaacacaccgaccaagaaaaaa
aaggattcatttgaccatgcctccgttacgtccttacatcgtcgtagcttatcctctaat
acttcaacacctcgaaagtatcattccagaaagccatactccgagccttctgtcatcgat
aaagagcatttacaaaaccgcgttagtatcggtactacgcatacccaaaatgatttgtat
cagtcttatgttgcatatcctgatgccctgcccttattcgctgctacccatccattcgag
agacgctatcctccttctctcctccatcaattcccttcttccaaggacataaaaaatgag
acaccgactattgaccgttgtgatttccctaattatgttccgatgtttgcttttcctaac
gacataactataaaagaatcggatgttagacctgtatcaacctaccactcttttgctttg
accagtgacaataacagccacttgtatgggatttgcgtggtagtttgggttgcaatgcct
caatctatgcaaaatgacttggaaaaggaatgtgaagtttggagagctaataatacgact
gtggaagaccgtgaggttgccgagaagcttttatccagtttagaaacggagcgatcaaaa
ctttcttcattattattaaaaatgcaagaaaaggaacttgaagggagtgattccatcgat
cctatactcttggaaaagattgatgtctgtgaagaaaacattattctttatactgaactt
cttcgtcctatgcgctataaattacctagatttgttcatggactgacaaataacaggact
ttatggatacccaatgcttatggattattgagtaagcattcacatttgcagtccttttgt
cgggattggcttcgaatagtatgctcctctattcaagctgaagatctcgattttatccct
tcgtcagatttaaattcccttaaatcactaaaccttcaatcgtttgtaaaaaacatttgc
tgtgatgttcctttgccgccgaaaggacttctgcagttgcaagttaatgtcggcccatta
aatctttacgcatttaggagtccagtcaatgaaatcccaggttggaatgatgttgactta
tatccgttatttcgtgcattaagtatccctaatattcttgttctttttgaggctgcttta
atggaagctaaagttatatttttgtctgaaaacttaggaatgctgggatatgcatcacaa
gctttactacatttgctttatcctcttacgtggcaagggctttatattcctgttttaccc
aggcgtttgatatcttgttttgaagctccttgttcgtacattattggcactctatcgtac
ttttttcatatggacgacgttcctctggacaatattccgcttgttgtttgtgaccttgat
aaaaattctgtatctacgtttgggaaaattgttcgtctttctcgctcattgcgatctaag
ttacaggcccatctgaagcttgcggcgccacttcatgataaattttatgtaccacatagc
cctccaaagtacacaatggaaacttatccaaataatgtcctttcgttgagtacagttaca
tgttttcctttgagagaaaagttttctatcccagcacttttgtcttttagaagctccaat
ttttccaaaaggccttatgtactctctcctatcttaaacggtttccttaagcttcaagac
aatccttcgagtatttattttgcgaagcaaactgactcgcgccagtcatcagcttcaaaa
cttttatatgcgcgtttacaggcgcctgagcatgctcgcaacttttcttctccccctttt
acgagacctgcttctccatcttcttcaaagtttcggttttcttcttcttctttccaatcg
acgataagaagaaattccctcacatcaccttattcggtccctgaacttcgttcttctgaa
tctaatcaaaataaagctggttctattaacaccggatctgctgtgaaccttgtgagttct
aagccaggagaacaaaaagttcacattatgtacaaagaggggcataagctgagacgcatc
tataaaatgtttcccgcggatagcgctggctccatttgcgctgtctcaggatatgcattg
ggtgacgtccatgttcaatgcgataattgtgggctacgtgttaatctggatttcataaaa
catatatcaatgccatgtgttccagcatgttttaatagtcagcagatattagtgacattt
ttaaaattctttataaaaatcttagggtcatatcggaattatttacgcaaacctcatatg
tctcgtgaaaattttggtatttctaaaggaagtggtggtcttataggatcattcgacttc
aataaatttactcggcaagcttccaaagttcacgggagttggatttcatcactttgtagc
tcacaggcatttgcagaattcattggcgatcgatgcgagcttgatctaaatgatccccga
gtggcactgtttgatcagttacttctttgtgaacgcaatcatggtaaaccaaggcttttt
ggaaaggccaccccttttctacgagacaagtcattggaaatccaaagaattgaggttgca
cctataccagcttcgttgaagaatgacaatgctttacactag

DBGET integrated database retrieval system