KEGG   Schizosaccharomyces pombe (fission yeast): SPCC297.06c
Entry
SPCC297.06c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: QIL1
Other DBs
NCBI-GeneID: 2539229
NCBI-ProteinID: NP_588363
PomBase: SPCC297.06c
UniProt: Q9UUN3
Position
III:complement(1885962..1886654)
AA seq 230 aa
MQGKINYKDITQKEMFNEIFKEYVKEEKQIDLGTCDQDSVHDLWRRFVKRWNDGKMKSKW
YSLGKRISQPSYARLVGPSRPTLENLQDRRELQEQLNELRKLSRKSAFKSQAKRETELLD
EILPKEPAGSKEAMQQKKKEKRAALKHYREASDNEEDLKETDLYGDRDSFQSRLKQKKQR
SEFRASKREMERLERDQELRNKIEERNKKELETIEKLRELAKARLQGFSS
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcaggggaaaatcaattataaagacattactcagaaagaaatgttcaatgaaatattt
aaagaatatgttaaggaagagaagcagatcgatttgggtacttgtgatcaagattctgta
cacgacctctggcgacgctttgtaaaaagatggaatgatggaaaaatgaaaagtaaatgg
tattcgttgggaaagagaatatctcaaccctcttatgctcgtcttgtaggtccaagtcga
ccaactttggaaaatttacaagatcgacgagaattgcaggagcaattaaacgagttgaga
aagctatcccgaaaatcagcttttaaatcgcaagctaaaagggagacagaattgttggat
gaaattcttccaaaagaaccagcaggaagcaaagaagctatgcaacagaaaaagaaggaa
aaacgagctgctttgaagcattatcgcgaagcatctgacaatgaagaagacttgaaagaa
accgacttatacggagaccgggactcatttcagtcccgattgaagcaaaaaaaacaacgg
tcagaattcagggcttcaaaacgagaaatggaaagacttgagcgcgaccaagagcttcga
aataaaattgaggaaagaaataaaaaagagttagaaacaattgaaaagctacgagagtta
gccaaggctaggttgcaaggtttttctagttga

DBGET integrated database retrieval system