KEGG   Schizosaccharomyces pombe (fission yeast): SPCC2H8.05cHelp
Entry
SPCC2H8.05c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APC_u14
Motif
Other DBs
NCBI-GeneID: 2539210
NCBI-ProteinID: NP_587975
PomBase: SPCC2H8.05c
UniProt: Q9Y7S8
Position
III:complement(832347..833000)
Genome map
AA seq 217 aa AA seqDB search
MQDSSKNKQPCVSWKVSPLKAKAMSPDDVSRLFCKSSTSSATRKHDPFHKLWDRLQPKAQ
STIQRTSSLPVPSSSNFKERLNNIGGLKRSRTLESSYEDETETANKLSRVSSLVSVIRQT
IDRKKSLERRVREEQEEKTDNEDDNDVEISTQESLENNGLAEKKDDTSSLATLEDDIEGQ
EFSFDDQDLQMLQDIEDQWLSSQKQQGSPLTSDHISK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattcttccaaaaataaacaaccatgcgtctcatggaaagtttctcctttaaaa
gcgaaagccatgtctcctgatgatgtctcaaggcttttttgtaaatccagtactagtagc
gctactcggaagcatgatccttttcataagctatgggatcgcttacaaccaaaagcacaa
tccactattcaacggacatcttcattgcctgttccttcgtcaagtaattttaaagagaga
ttaaataatataggaggacttaagaggtcaaggacattggaaagctcctatgaagatgaa
acagagactgcaaataagctgtcacgggtttctagtttggtgagcgtgatacgacaaact
atagatcgcaaaaaatcactagaaagaagggtaagggaagaacaagaagagaagacagat
aatgaggatgataatgatgtcgaaatatctactcaggaatccctggaaaacaatggttta
gcggaaaagaaggatgatacttcatcacttgctacgttggaagatgacattgagggccaa
gaattttcgtttgatgaccaagatttacaaatgcttcaggacatagaagaccaatggctc
agttctcaaaaacagcaaggttctcctctaacatcagatcatataagcaaatag

DBGET integrated database retrieval system