KEGG   Schizosaccharomyces pombe (fission yeast): SPCC31H12.07
Entry
SPCC31H12.07      CDS       T00076                                 

Symbol
sec231
Name
(RefSeq) putative COPII cargo receptor subunit Sec23a
  KO
K14006  protein transport protein SEC23
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SPCC31H12.07 (sec231)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spo04131]
    SPCC31H12.07 (sec231)
Membrane trafficking [BR:spo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    SPCC31H12.07 (sec231)
SSDB
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin Vps36-NZF-N
Other DBs
NCBI-GeneID: 2538699
NCBI-ProteinID: NP_587900
PomBase: SPCC31H12.07
UniProt: O74873
Position
III:join(634309..634339,634389..634560,634620..634651,634717..636761)
AA seq 759 aa
MNFEEIEERDGVRFTWNVFPSTRIESSRTIVPIASIYKPLNERPDLPPVLYEPVTCKAPC
KAVLNPYCHIDTRAKFWICPFCLQRNMLPPQYKDISNTSLPIELLPEYSTIEYTLPRPPQ
LTPVFLFVVDVCQDEENLQALKDSLIISLSLLPPECLVGLVTFGTMVDVYELGYTECSKS
YVFRGSKDYTSKQIQEMLGLPTSNVSPVALQQARSFQGSAAPSRFLLPIQQCEFQLTNIL
EQLQPDSWPVANDRRPQRCTGTALNISVSMMESVCPNSGGHIMLFAGGPSTVGPGTVVST
ELREPIRSHHDIERDQAKHVKKALRFYEGLTKRVSANGHAVDILAGCLDQIGIMEMKSLA
SSTGGYLVLSDSFTTSIFKQSFQRIFGRDSLNNMLLGFNATMEVLTTKELKISGLIGHAV
SLNKKSQNVGDIEIGLGNTNSWKMCGISPKSTYAIYFEVATQSASAPQGDSRGLVQYLTL
YQHSSNTFRLRVTTVARAFADGGSPLIVNSFDQEAAAVAMARIAAFKAEVDDGPDVLRWT
DRMLIKLCQKFAEYRKDDPSSFRLSSQFTLYPQFMYYLRRSPFLQVFNNSPDETAFYRHM
LNHEDVNNSLIMIQPTLQSFSFEHPGGVPVLLDAVSVKPDVILLLDTFFHILIFHGDTIA
QWRNAGYQNQPEYQNLKELLEAPRVEAAELLIDRFPIPRFIVCDQGGSQARFLLSRLNPS
ETHNTTSMYGAPPAHAILTDDVSLQTFMSHLKKLAVAVS
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgaatttcgaagaaatcgaagaacgtgacggagttcgttttacctggaacgtgtttcca
tcgacgagaattgaaagttcacgaacgatcgttcctattgcttcgatttacaaaccttta
aatgagcgtcctgatttaccacctgttctatatgaacctgttacttgcaaggctccatgc
aaagctgttttaaatccctactgccatattgacactcgtgcaaagttctggatttgtcca
ttttgtcttcaacgtaatatgttaccacctcaatataaggacatttccaatactagtttg
ccaattgagttattgccggaatattctacgattgaatatactttgcccagaccaccccaa
ctcactccagtctttcttttcgtggttgatgtctgccaggacgaagaaaacttgcaagct
ttaaaagattctttaatcattagcttaagcttactcccccctgaatgcctagttggctta
gttacctttggcaccatggtagatgtttatgaacttggctacactgaatgttctaaatct
tatgttttccgcggatctaaggactacacttccaagcagattcaggaaatgcttggtttg
cccactagtaatgtttctccagtcgccttacaacaagctcgctctttccaaggctcggct
gctccatcgcgcttcctccttcccattcaacagtgtgaatttcaacttactaacatcctc
gaacaactacaacctgattcttggcctgttgccaatgacagacgtcctcaacgttgtact
ggtaccgctttgaacatttctgtaagcatgatggaaagtgtttgtcccaacagtggtggt
catattatgctttttgctggtggccctagcaccgttggtcctggaactgttgtttctacc
gaacttcgtgagccaattcgttcgcatcacgacattgaacgtgaccaggcaaagcacgta
aagaaggcactgcgcttttatgaaggccttaccaaacgtgtcagcgccaatggacatgct
gtagacattcttgccggatgtctggatcaaatcggaattatggaaatgaaaagcctggct
tctagcactgggggttaccttgttctatctgattctttcactacttctatctttaagcaa
agttttcaaagaatatttggtcgtgattctttgaataatatgcttcttggatttaatgca
actatggaggtccttacaactaaggagttgaaaatttccggtcttatcggccacgcagta
tccctaaacaagaaatcacaaaatgttggcgatatcgaaattggccttggtaacactaat
agttggaaaatgtgtggtatatcaccaaagtccacttatgccatttactttgaagtagct
actcaaagtgcctctgcccctcagggggactctcgaggtttggtacaatatctaaccttg
tatcaacattcatcaaacacattccgacttcgtgtaacaacagtggctcgcgcttttgct
gatggaggtagtccattgatcgtaaattcatttgatcaagaagctgctgctgttgctatg
gctcgtattgcagctttcaaagcggaagtcgatgatggacctgacgtccttcgatggacc
gaccgaatgctgatcaaactttgtcaaaagtttgctgagtatagaaaagatgatccgtca
agtttccgtctctcttcacaatttaccctttaccctcaatttatgtattacttacgacgt
agcccctttctgcaagtttttaacaattcaccagatgagactgcattttatcgtcacatg
ctcaaccatgaagatgttaacaattctcttattatgattcaacctaccttgcaatcattt
tctttcgaacaccctggtggcgttccagtgctgctggacgctgtatctgtaaaaccggat
gttattctcttgctcgatactttcttccatattctaattttccatggggacactatagcc
caatggagaaatgctggctatcaaaatcagcctgaataccaaaacctaaaagaactttta
gaagctcctagagtcgaagcagcggagttgcttattgatcgattcccgatccctcgattt
atcgtttgtgaccagggaggcagtcaggcacggtttcttctttctcgccttaatccttct
gaaacgcacaacactacgtctatgtatggtgctccacctgctcatgctattttaactgat
gatgtctccttacaaaccttcatgagtcatctgaaaaaacttgccgtagctgtttcataa

DBGET integrated database retrieval system