KEGG   Schizosaccharomyces pombe (fission yeast): SPCC31H12.08c
Entry
SPCC31H12.08c     CDS       T00076                                 

Gene name
ccr4
Definition
(RefSeq) putative CCR4-Not complex subunit Ccr4
  KO
K12603  CCR4-NOT transcription complex subunit 6 [EC:3.1.13.4]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SPCC31H12.08c (ccr4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:spo03019]
    SPCC31H12.08c (ccr4)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     SPCC31H12.08c (ccr4)
Messenger RNA biogenesis [BR:spo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     SPCC31H12.08c (ccr4)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     SPCC31H12.08c (ccr4)
SSDB
Motif
Pfam: Exo_endo_phos LRR_4 LRR_8
Other DBs
NCBI-GeneID: 2538913
NCBI-ProteinID: NP_587901
PomBase: SPCC31H12.08c
UniProt: O74874
Position
III:complement(637461..639533)
AA seq 690 aa
MFNPRYTQGTIYPGAHPGLLTPDHQHAAILSVQNSPALENSNISEHWKQQIALATQSRSF
SSPHQRAHNAAALARSGGPGFSMNYNARTGAFTGGPNAAGLSSLGGKYNTSSTTTTLTTS
TTLNTSSGTTLNSTSKTTTSSVAVDDQKSKSDSKKERRDWTCLDLGGIGLRNVSTDLFKF
SFLTELYINHNNLTRLPPEIGKLKNLVILDASGNSIKTIPPELGLLTELREVLLFDNMIS
VIPAELGTLFQLKILGIEGNPLQDVYKNQIMESGTAGLIAALRDGCPVGPPPPERGWEKL
VSDDDDDVNDNVSTSVRDLTAADSNKPSTTSKNLKFTIMSYNVLCERYATSTLYGYTPSW
ALSWSYRKDLIMQELGGYNADIICLQEVDVENYDTFFAPQMSLKGYKGVHFPKSRVRTMN
EVERRIVDGCATFFKTSKYVMHEKMVIEYNQAPSLRRQDIKLTSNMYNRVMTKDNISVIT
LLENKENGSRLIVANCHIHWDPQFRDVKVIQVAMLMDEIAQVATKFRNMPSKIPSDQLKD
ERPTYPEYLKIPILICGDFNSVQGSGVYDFLSSGSISQNHEDFMNNDYGEYTVNGRSHAF
NLKSAYGESEALSFTNYTPGFKGAIDHIWYTGNSLEVTGLLKGVDKDYLSGVVGFPNAHF
PSDHICLLAEFKVKQEKTPLPSSKFNNDKK
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgtttaatcctaggtatacgcaaggtacaatttatccaggagcgcacccggggctgttg
acgccagaccatcaacatgcagcaatattatctgtacagaattcgccagctttagaaaat
agtaatatttctgaacattggaaacagcaaattgcacttgcaactcagtccaggtccttc
agttcaccacaccaacgagctcataatgctgcggctttagcacgaagtggaggacctggg
ttttcgatgaattacaatgctcggactggagcttttaccggaggccctaatgctgctggc
ttatcctcgttagggggaaagtacaatactagctccactactacaacattgacgacctca
acaacattaaacacttccagtggtactaccttaaacagtacgtcaaaaacaaccacttct
tctgttgcggttgatgaccaaaagtcgaaatctgactctaagaaagagagacgggattgg
acttgtttggaccttggtggtattggtttgagaaatgtgagcactgatttatttaaattc
tcttttttgactgaattatacataaaccataataatcttacccgattaccacctgaaatt
ggcaaactgaagaatttggttattttggatgcctctggaaacagcattaaaactattcca
ccagagcttggtttacttactgagcttagagaagtcctattgtttgataatatgattagt
gtaatacctgccgaactcggtacccttttccaattgaaaattcttggtattgaaggtaat
cctcttcaagacgtttacaagaatcaaatcatggaaagtggtactgcaggtttaattgct
gctttgcgcgatggttgccctgttggccctcctcctcctgagcgtggatgggaaaaactt
gtttccgatgatgatgatgatgttaatgacaatgtttcaacctctgttagagatttaacg
gctgctgattctaacaagccctctacaacatctaagaatctcaagtttactattatgagt
tataatgtgctttgtgaacgttatgctacatccacattgtatggctatactccttcatgg
gcactctcttggtcgtatcgcaaagatttaatcatgcaagaattaggtggttataatgct
gatatcatttgtttgcaagaagttgatgttgagaactatgatactttttttgctccacaa
atgagtttgaaaggttataaaggtgtccacttcccgaaaagtcgcgtacgaactatgaat
gaggttgaacgtcgcatcgtcgatggttgtgctacatttttcaaaacatctaaatatgtc
atgcacgaaaagatggtgatagaatataatcaagcaccatctcttcgtaggcaagacatt
aaactaacgtctaacatgtacaaccgtgttatgactaaagataacattagtgtgattact
cttcttgagaataaggaaaatggatcgcgattgatcgttgcaaattgtcatattcattgg
gatcctcagtttagggatgtcaaggttatacaagttgcaatgctcatggatgagattgca
caggttgcaacaaaattccgtaatatgccttccaagattccttctgaccagttaaaggat
gaaagacctacctatcccgagtatttaaagatccccatcttaatttgtggagattttaat
tccgtccaaggcagtggtgtttatgactttttatcatctggtagcattagccaaaatcat
gaagattttatgaataatgattacggagaatacactgttaatggacgttctcatgcattt
aatttgaaatctgcatatggtgaatctgaagctctctccttcactaactatacacctggc
tttaagggtgccattgatcacatttggtacaccggcaatagcttggaggtaaccggtttg
ttgaaaggagtggataaagattatctttccggcgttgttggtttccctaacgcacacttc
cctagtgatcatatttgcttgctggccgagtttaaagtgaaacaggagaagacaccctta
ccttcatcaaagtttaacaatgataaaaaatga

DBGET integrated database retrieval system