KEGG   Schizosaccharomyces pombe (fission yeast): SPCC320.06
Entry
SPCC320.06        CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Other DBs
NCBI-GeneID: 2538995
NCBI-ProteinID: NP_587723
PomBase: SPCC320.06
UniProt: O59783
Position
III:complement(join(158577..159193,159251..159503))
AA seq 289 aa
MVLISNTLHCADAYSSADSKHVPLTLSTRRINLQSFQSISARNCGSDARVLDFVKSIDND
NSWKRRNLDSKRNIGSRKKNRFLNDLHILKQAADDPDEVVYKDLFTHRPAFGFLTVGDEF
YKDGVNNISSLLTSSSNQRFNDNHHKSIVKRIRHEIKCYNSLQLVLLLDECLNNIMNEKL
YAYDHDHSPAIYASESFNIKAEIDTSSFLETQRSYRIYMLIDCPSNPKATAFARYWMHLI
CSYYGIYTTSTQILSNKIMTLGVSKKRKHLSFKTLSELLNHDELTNINR
NT seq 870 nt   +upstreamnt  +downstreamnt
atggttctcatttcaaatacattgcattgcgcggatgcttattctagtgccgactcaaag
catgttccactaactctctcaaccagaaggataaacctacagtcgttccaatccatttct
gctcgtaactgtggatccgatgcgcgtgttttagattttgttaaaagtattgacaatgac
aattcatggaaaagaaggaaccttgattccaagagaaacatcggttcgaggaaaaagaat
cgtttccttaatgacttgcatatattaaagcaagcagcggatgatcctgatgaggtcgtt
tataaggatttatttacccacagaccagcttttggttttttaaccgttggagatgagttt
tacaaggatggagtaaataatatatcttcattgctaacatcatcatcgaaccagaggttt
aacgacaatcaccataaatccattgttaaaaggattagacatgaaatcaaatgttacaac
tctctgcaactagtgttgttgttggacgagtgcttgaataatattatgaacgaaaagctt
tatgcttatgaccacgaccattcaccagcgatatatgcttcggaaagctttaatattaaa
gcagaaattgatacgtcttcttttttggaaacgcagagaagctatcgaatttatatgtta
attgattgtcctagcaatccgaaagcaacagccttcgctcgatattggatgcatttgatt
tgctcatattatggtatttacactacttctacacaaatcttatcaaacaaaataatgacc
ctcggtgtttctaaaaaacggaagcatttgtcattcaaaactctttccgaacttttaaac
catgacgaactaacaaacataaatcgttaa

DBGET integrated database retrieval system