KEGG   Schizosaccharomyces pombe (fission yeast): SPCC320.09
Entry
SPCC320.09        CDS       T00076                                 

Gene name
hem15
Definition
(RefSeq) putative ferrochelatase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00860  Porphyrin and chlorophyll metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPCC320.09 (hem15)
Enzymes [BR:spo01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     SPCC320.09 (hem15)
    4.99.1.9  coproporphyrin ferrochelatase
     SPCC320.09 (hem15)
SSDB
Motif
Pfam: Ferrochelatase
Other DBs
NCBI-GeneID: 2539199
NCBI-ProteinID: NP_587720
PomBase: SPCC320.09
UniProt: O59786
Position
III:complement(join(149153..150163,150279..150323,150374..150472))
AA seq 384 aa
MSVSSYSSDASSTVMDESPPNGVTKSVSGKGPTAVVMMNMGGPSNLDEVGPFLERLFTDG
DIIPLGYFQNSLGKFIAKRRTPKVQNHYSDIGGGSPILHWTRIQGSEMCKILDKKCPESA
PHLPFVAFRYAPPLTEDMLDELKKANVSRAVAFSQYPQWSCATSGASLNELRRKLIEKGM
EKDFEWSIVDRWPLQQGLINAFAENIEETLKTYPEDVRDDVVIVFSAHSLPMSQVAKGDP
YVYEIAATSQAVMKRLNYKNKFVNAWQSKVGPLPWMSPATDFVIEQLGNRGQKNMILVPI
AFTSDHIETLKELEDYIEDAKQKGITGVKRVSSINGSMTAIQGMADLVAEHLKAKVPYSR
QFTQRCPGCTSESCAERINFFQDF
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtcggtctcgtcttatagttctgatgcttcttccaccgttatggatgaaagtccaccg
aatggcgttactaagagcgtttctggtaaaggacctacagctgttgtcatgatgaacatg
ggtgggccttccaatttagatgaggtgggcccctttttggagcgtctattcactgatggt
gatattattcctctcggttattttcaaaattcattaggaaaattcattgcgaaacgtagg
acacctaaagttcaaaatcactattccgacattggtggaggaagtccaattttacattgg
actcgtatacaggggtcggaaatgtgcaaaatccttgataaaaaatgtccagagtccgcc
ccacatcttccatttgtagcctttcgttatgctcctcctttgactgaagatatgttagat
gaattaaagaaagcaaatgtttcgcgcgctgtcgcattcagtcaatatcctcaatggtct
tgtgccacgagtggtgcttctctcaatgaattacgaagaaaacttattgaaaagggaatg
gaaaaagatttcgaatggtcaattgtagaccgttggcctttgcaacaaggtctcattaat
gcatttgctgaaaacattgaggaaacattgaagacatatcctgaagatgttcgtgatgat
gttgttatagtttttagtgctcattcattaccaatgagtcaagtagcgaaaggtgatcct
tatgtttatgagattgctgctactagccaagccgttatgaaacgtttaaattacaagaat
aaatttgtgaacgcttggcaatcaaaggttggacctttgccttggatgtctcctgcaaca
gactttgtaattgagcagttgggtaaccgaggacagaagaatatgattctcgttcctatt
gcttttacttctgatcacattgagactctgaaggagttagaagattacattgaagatgca
aagcaaaagggaattaccggagttaaacgtgtttcaagcattaatggaagtatgacagct
attcaaggaatggctgacctggttgcagagcatttaaaggctaaagtaccctattctcgt
caatttacccaacgatgcccaggatgtacaagcgaatcttgtgctgaacgtattaatttc
tttcaagatttttaa

DBGET integrated database retrieval system