KEGG   Schizosaccharomyces pombe (fission yeast): SPCC320.12
Entry
SPCC320.12        CDS       T00076                                 

Symbol
atp23
Name
(RefSeq) putative peptidase Atp23
  KO
K18156  mitochondrial inner membrane protease ATP23 [EC:3.4.24.-]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPCC320.12 (atp23)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     SPCC320.12 (atp23)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPCC320.12 (atp23)
SSDB
Motif
Pfam: Peptidase_M76 Tox-MPTase2 SprT-like
Other DBs
NCBI-GeneID: 2538697
NCBI-ProteinID: NP_587717
PomBase: SPCC320.12
UniProt: Q1MTR0
Position
III:complement(join(143220..143227,143294..143843))
AA seq 185 aa
MSEDPQSWSKERKNCERVKRALMSQSPVIIFLKTALDRLNCNIEAKDISCQPCDAQSTGG
YIPGKGIVLCENRLYTKKMAENTIAHEMIHMFDDHRFEVDWNNLRHQACSEIRASSMSGE
CRWTKELRFGNIKTFRKHHQECVKRRATISVQGNPNCKSKEQAEAIVEEVFNSCFNDFRP
FEKIY
NT seq 558 nt   +upstreamnt  +downstreamnt
atgagcgaagatccacaaagttggtcgaaagagaggaaaaattgtgagcgcgtaaagcgc
gctttaatgtcccaatctccagtaattatttttttaaaaactgccttggatcgtttgaat
tgcaacattgaagctaaagacatttcttgccagccttgtgatgcacaaagtactggaggt
tacattcccggtaaagggatagttctgtgtgaaaacagactttatactaaaaaaatggca
gagaatacaattgcccatgaaatgatacacatgtttgacgaccacaggtttgaagtcgat
tggaacaatttgagacatcaggcttgttcagaaattcgtgctagtagtatgagtggtgag
tgtcgctggaccaaagaacttcgttttggtaacattaaaacttttcggaagcatcatcaa
gaatgcgtcaaacgacgagctactatctccgtacaaggtaacccgaattgtaaaagcaaa
gagcaagcagaagcaatcgttgaagaagtgttcaattcctgtttcaacgatttcaggcct
tttgaaaaaatctattga

DBGET integrated database retrieval system