KEGG   Schizosaccharomyces pombe (fission yeast): SPCC320.13c
Entry
SPCC320.13c       CDS       T00076                                 

Gene name
ark1
Definition
(RefSeq) aurora-B kinase Ark1
  KO
K08850  aurora kinase, other [EC:2.7.11.1]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spo01001]
    SPCC320.13c (ark1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spo03036]
    SPCC320.13c (ark1)
Enzymes [BR:spo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SPCC320.13c (ark1)
Protein kinases [BR:spo01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   SPCC320.13c (ark1)
Chromosome and associated proteins [BR:spo03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    SPCC320.13c (ark1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 Pkinase_fungal Kdo YrbL-PhoP_reg RIO1 Haspin_kinase FTA2
Other DBs
NCBI-GeneID: 3361036
NCBI-ProteinID: NP_001018849
PomBase: SPCC320.13c
UniProt: O59790
Position
III:141662..142729
AA seq 355 aa
MSDSKLADSLNCLSVSTPSTTANPGRQQLLRLAVSNQRQVNNVSLANGKENKRTSNSKFN
SSLRKIEEPIAGVPSSAGPQWREFHIGMFEIGKPLGKGKFGRVYLAKEKKTGFIVALKTL
HKSELVQSKIEKQVRREIEIQSNLRHKNILRLYGHFHDEKRIYLILEFAGRGELYQHLRR
AKRFSEEVASKYIFQMANALSYLHKKHVIHRDIKPENILLGIDGEIKLSDFGWSVHAPSN
RRTTLCGTLDYLPPEMVEGKEHTEKVDLWSLGVLTYEFLVGAPPFEDMSGHSATYKRIAK
VDLKIPSFVPPDARDLISRLLQHNPEKRMSLEQVMRHPWIVKYKDSWTRKSSESS
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgtcagattcaaagttggcagattctttgaattgcctttctgtgtcaactccatcaacc
acagctaatcctgggagacaacagcttttacgacttgcagtatcaaaccaacgacaagta
aataatgttagtctagcaaatgggaaggaaaacaaacggacttcaaatagcaagttcaat
tcttcccttcgtaagatagaagagccaattgctggagtaccttcatcagctggtcctcaa
tggcgagaatttcatattggaatgtttgaaattggaaaacccttagggaaaggaaagttt
ggaagggtatatctagctaaagagaagaagaccgggtttattgtggctctcaaaacattg
cataagtctgaacttgtccagtcaaagatagaaaagcaagttcgacgagaaattgagatt
caatcaaatcttcgccataaaaacattttacggctatatgggcactttcatgatgaaaaa
aggatttatttgattttagagtttgctggcaggggtgagttgtatcaacacttgcgtcgt
gcaaaacgattctcagaagaagttgcgtctaaatatatcttccaaatggctaacgcctta
tcctacttgcataagaagcatgtaatacaccgtgatatcaaacctgagaacattttatta
ggaattgatggagaaatcaagctttctgactttggttggagtgtccatgcaccttctaac
cgtcgtaccactttatgtggtacattagattacttaccacctgaaatggtggagggaaaa
gagcataccgaaaaagttgatctctggtcgttgggtgtcttaacttatgagtttttggtg
ggagcaccgccttttgaggacatgtctggtcattcagctacgtataagcgtatcgccaaa
gttgacttaaaaattccaagctttgttcctcctgatgcacgggatcttatttctcgtcta
ttacagcataatcctgaaaaaagaatgagtttggaacaagttatgaggcacccttggatt
gtaaaatataaagattcatggactcgcaaaagttctgaatcttcctaa

DBGET integrated database retrieval system