KEGG   Schizosaccharomyces pombe (fission yeast): SPCC330.01cHelp
Entry
SPCC330.01c       CDS       T00076                                 

Gene name
rhp16
Definition
(RefSeq) ATP-dependent helicase
  KO
K15083  DNA repair protein RAD16
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC330.01c (rhp16)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     NER4 complex
      SPCC330.01c (rhp16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N Helicase_C zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 DEAD zf-C3HC4_3 zf-RING_2 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 2538860
NCBI-ProteinID: NP_587701
PomBase: SPCC330.01c
UniProt: P79051
Position
III:complement(102685..105576)
Genome map
AA seq 963 aa AA seqDB search
MHISTLKVDQLQNEAVDINSNDTIDSINWKNTRNNHTTQASLQADNNDEQSNGQAPFSTT
YSEINNIHDVPGNQDEWSSSPIAGIIVESEDEEVVENNLHSQMGTSCNKINSNSNKGKEN
MHFVLDDNGDSKGNASNQQVERDDKLDMETTRWNGKEFEEPLSTNKKLIIQSNNTSSQHS
TPPLSISDTSTHTGSSTDNVEANPNTGFSSARKRSLRSSNLKKKFVPLSSPEESNESEFI
DDDESDEVASIIDIKEDETFDSKVEIPEAAPSSSTESDEESIPLSYQSKRRRVSARASSS
ASSSSRTQAKSIPSHERTHYRLIRQHPELEHVWEKLEEEAPREVKQIEQPKELVLNLLPF
QREGVYWLKRQEDSSFGGGILADEMGMGKTIQTIALLLSEPRGKPTLVVAPVVAIMQWKE
EIDTHTNKALSTYLYYGQARDISGEELSSYDVVLTSYNVIESVYRKERSGFRRKNGVVKE
KSLLHQMEFYRIILDEAHGIKSRTCNTARAVCGLRTTRKICLSGTPLQNRIGELFSLLRF
LRADPFAYYYCLQCECKSLHWRFSDRSNCDECGHKPMSHTCYFNAEMLKPIQKFGYEGPG
KLAFKKVHSLLKHIMLRRTKLERADDLGLPPRVVEVRKDLFNEEEEDVYQSLYMDSKRKF
NTYLAEGVVLNNYANIFQLITRMRQMADHPDLVLASKRKTVDIENQENIVCKICDEVAQD
AIESRCHHTFCRLCVTEYINAAGDGENVNCPSCFIPLSIDLSAPALEDFSEEKFKNASIL
NRIDMNSWRSSTKIEALVEELYLLRKKDRTLKSIVFSQFTSMLDLIHWRLRKAGFNCVKL
DGGMTPKARAATIEAFSNDINITIFLVSLKAGGVALNLTEASQVFMMDPWWNGAVQWQAM
DRIHRIGQKRPIKVITLCIENSIESKIIELQEKKAQMIHATIDQDEKALNQLSVEDMQFL
FSN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atgcatatatctactctaaaagtggaccaattacaaaatgaagctgtagatattaattca
aacgatacaattgattccataaattggaaaaatactcgcaataaccatactactcaggcg
tctcttcaagcagacaataatgatgagcaaagtaatgggcaggctccattttctactact
tattcagagataaataacattcatgatgtaccaggcaatcaagatgaatggtcatcttct
cccattgcgggcattattgtagaaagtgaagatgaggaagtggttgaaaacaatttacat
tcacaaatggggacgtcatgtaataaaataaactcgaatagtaataagggaaaagaaaat
atgcattttgttctagatgataatggtgattcaaaggggaatgcttcaaatcaacaagtc
gagcgtgacgacaagttagatatggagacaacgcgctggaacggaaaagagtttgaagaa
cctctgtcaacaaacaaaaaattgattatccagtcaaacaacacctcatctcaacattcg
acacccccattatccatttctgataccagtacacacaccggtagcagcacagacaatgta
gaagcaaatcccaatacaggtttttctagtgccagaaaacgttcattaaggtcctcgaat
ttgaaaaaaaagtttgtgccattgtcatctccagaagaatctaatgaatccgaatttatt
gatgatgatgaaagtgatgaagttgctagcataattgatatcaaagaggatgaaactttt
gatagtaaagtagaaattccagaagctgctccaagttcttctacggaaagtgatgaagag
tcaatccctttaagttaccagtccaaacgaaggagggtatccgctagggcttcttcttcc
gcgtcctcttcctctagaacacaagcaaaatcaattccatcacatgaaagaacccattat
cgtctgattcgacaacatcctgaactagaacatgtttgggagaaattggaagaagaagca
cctcgtgaagtgaaacagatcgagcaacccaaagagttggtcctaaaccttctccctttt
caacgagaaggtgtatattggttaaaacgacaagaagattcctcttttggtggaggaatc
ttggccgatgaaatgggtatgggtaagactattcaaacaattgcgttgttgctttcagaa
cctcgaggtaagccaaccttggttgttgctccggttgtagcaattatgcaatggaaagaa
gagattgatacacataccaataaagcactgagtacatatctttattatggccaggctcgt
gatatttcaggagaagagctttcgagctatgatgttgtactaacgagttacaatgtaatt
gaatcagtttacaggaaggaacgcagcggattcagaaggaaaaacggtgttgtaaaagaa
aagtcattacttcatcaaatggagttttaccgaattatacttgatgaggcccatggtatc
aaatcaaggacttgtaacactgccagagctgtttgtggcttaagaacgacaagaaagata
tgtctttcaggaacacctttgcaaaaccgtattggagaattattttcacttcttcggttc
ctacgggcagatccttttgcttactactattgcttgcaatgtgaatgtaaatctctgcac
tggagattttccgatagaagtaattgcgacgaatgcggccataaaccaatgagtcatact
tgctattttaacgctgaaatgctaaaaccaatacaaaagtttggatacgaaggtccagga
aagctagcttttaaaaaggtgcattctttattaaaacacattatgttacgtcgaacaaaa
ttagagagggctgatgaccttggattacctcctcgagtcgttgaagtgaggaaagattta
ttcaacgaagaagaggaagatgtataccaatctttatatatggattcaaaaagaaaattt
aatacatatcttgctgaaggtgtcgttttgaataattatgcaaacattttccagctaatt
acacgaatgcgccaaatggcagatcatcctgacctggtgttagctagcaaacgaaaaaca
gttgatattgaaaatcaggaaaatatcgtctgtaagatttgtgacgaagtcgctcaagat
gctatagaatcacgttgccatcacacattttgtcgactctgcgttacggaatatatcaat
gcagctggtgatggagaaaatgtcaactgtccaagttgtttcattcccttaagcatagat
cttagtgcccctgctttagaagatttttctgaagagaagtttaagaatgcatcgattttg
aatagaattgatatgaatagttggcgttcatctacaaaaattgaagcattagttgaggag
ctttacttacttcgtaagaaggaccgaacactgaagtcgattgttttctctcaatttact
tctatgttagatctcattcattggcgacttcgaaaagccgggtttaattgtgtaaagcta
gatggtggtatgacccccaaagcgagagcagctactattgaggctttcagtaacgatatt
aatattaccatttttctagtttcgttgaaagcaggtggtgttgctttgaaccttacagag
gcatctcaagtgtttatgatggatccttggtggaatggagctgtacagtggcaggcaatg
gatcgaattcatcgtattggacaaaaaaggccgataaaagtaattaccctgtgtattgaa
aattccattgaaagcaaaattattgaactacaagaaaagaaagctcagatgatacatgca
accatagatcaagacgaaaaggctttgaaccagctttctgtcgaggatatgcaattcttg
ttctcaaattag

DBGET integrated database retrieval system