KEGG   Schizosaccharomyces pombe (fission yeast): SPCC330.06c
Entry
SPCC330.06c       CDS       T00076                                 

Definition
(RefSeq) putative thioredoxin peroxidase
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Redoxin AhpC-TSA
Other DBs
NCBI-GeneID: 2538981
NCBI-ProteinID: NP_587706
PomBase: SPCC330.06c
UniProt: O14313
Position
III:complement(118423..118893)
AA seq 156 aa
MVAVGSTLPKVTLWENKPEEVVEFPSQGKFIIVGVPGAFTPPCSSQVPGYIANEKQFAAK
GISGIYVVAVNDVFVTKAWKKSFDGGEQSGVHFVADWNGEFTKAFDAGFDASGLLGPLRS
KRYAAVVENGKVVKVFIENEVTDVDISSADKVLSSL
NT seq 471 nt   +upstreamnt  +downstreamnt
atggttgctgtcggatctactttgcctaaagttactctttgggaaaacaagcccgaagag
gttgttgaattcccttctcaaggcaaattcatcattgtcggtgttcccggcgctttcact
cctccttgttcttctcaagttcctggctatattgcaaatgagaagcaatttgctgccaag
ggcatcagcggaatctatgtcgttgccgtaaatgacgttttcgtcaccaaggcttggaag
aagtctttcgacggtggtgagcaaagtggtgttcactttgtcgccgactggaacggagag
tttaccaaggcctttgatgctggcttcgacgctagcggtcttttgggccctcttcgctcc
aagcgttatgccgctgttgtcgagaatggcaaggttgtcaaggttttcattgagaacgag
gtcaccgatgttgatatttcctccgctgacaaggtccttagctctctttaa

DBGET integrated database retrieval system