KEGG   Schizosaccharomyces pombe (fission yeast): SPCC330.08Help
Entry
SPCC330.08        CDS       T00076                                 

Gene name
alg11
Definition
(RefSeq) alpha-1,2-mannosyltransferase Alg11
  KO
K03844  alpha-1,2-mannosyltransferase [EC:2.4.1.131]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00510  N-Glycan biosynthesis
spo00513  Various types of N-glycan biosynthesis
spo01100  Metabolic pathways
Module
spo_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    SPCC330.08 (alg11)
   00513 Various types of N-glycan biosynthesis
    SPCC330.08 (alg11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spo01003]
    SPCC330.08 (alg11)
Enzymes [BR:spo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.131  GDP-Man:Man3GlcNAc2-PP-dolichol alpha-1,2-mannosyltransferase
     SPCC330.08 (alg11)
Glycosyltransferases [BR:spo01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   SPCC330.08 (alg11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALG11_N Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 2539054
NCBI-ProteinID: NP_587708
PomBase: SPCC330.08
UniProt: O74878
Position
III:124563..125978
Genome map
AA seq 471 aa AA seqDB search
MITTLAIALFIAVVAIHSHIRRKICKEIGIRLIKKIAPVKASLYKQVGVEPKLARTVGFF
HPYCNAGGGGERVLWTAVKSVQTEFPNVISVVYTGDNVSKAEILRRVKNTFEIDLDSSKI
VFVYLKLRFLVSATTWHRFTLLGQSLGSMILGFEAIYRFAPDIFIDTMGYAFTFCVVKSF
QNIPVGAYVHYPTISTDMLKSLKQVSLLAKVKMAYWRWFAQLYSDAGSHADYVMTNSSWT
RNHIASLWGKDIQLSVVFPPCNTSELEKIDINRKREPTLLYLAQYRPEKNHENVLRSFAL
YFEQHPDSPAKLLLVGSVRGEEDMCFVNHLKTLATELNLQSKVKFVVDAPWPKVVEYLGT
CSIGVNYMWNEHFGIGVVEYMAAGLIPVVNNSGGPKFDIVIPWIGKPTGFHASTISEYAE
AYHKALTLSPQEQLEMRINARSACARFGEHVFMRDFGNVFAKLLREDYSRT
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgattacaacacttgccattgctcttttcattgctgtggtcgccatccattcacatata
cgaagaaaaatatgcaaggaaattggaattcgacttatcaaaaagatagcccctgtgaaa
gctagtttatacaaacaagtgggcgtggagccgaaactagcaagaaccgtcgggtttttt
catccttactgcaatgctggaggcggaggtgaacgagtattatggacagctgtcaaatct
gtccaaacggagtttccaaatgttatttctgttgtgtatactggcgacaatgttagtaaa
gccgaaattctgcgcagagtcaagaatacatttgaaatcgacctggattcttccaaaata
gtttttgtttatctaaaacttcgtttccttgtgtccgccactacttggcatcggtttaca
ttgcttggacaatcgctaggaagtatgattttaggtttcgaagctatttatcgatttgca
cctgacattttcattgacaccatgggatatgctttcactttttgtgtcgttaaaagcttc
caaaatattcctgtcggcgcgtacgttcattatcccacgatttctaccgacatgctaaag
tccttaaaacaagtatctctacttgctaaggttaaaatggcttactggagatggttcgct
cagttgtattcagatgccggatctcatgcggactatgtgatgactaactcttcatggacg
agaaaccacattgcatctctttgggggaaagatattcaactctccgttgttttccccccc
tgtaacacttcagagcttgaaaagatcgacattaacagaaagcgcgaacccactcttctt
tatcttgcacaatacagacctgaaaagaatcatgaaaatgtacttcgtagttttgctctc
tattttgaacagcatcctgattctccagcgaagctattactggtcggtagcgttcgaggt
gaagaagacatgtgttttgtgaatcatttgaagacccttgcgactgaactcaacttacaa
tcaaaagtcaaatttgttgtagatgctccttggcccaaggtagttgagtatctaggtact
tgctctataggtgtcaattacatgtggaatgagcattttgggattggtgtcgttgaatac
atggctgctggtttaatacctgttgtcaacaattcgggtggcccaaagttcgatatcgtg
attccatggattggaaagcctacaggttttcatgctagcaccattagcgaatatgctgaa
gcctaccataaagctcttacattgagtcctcaagagcaattagagatgagaatcaatgct
cgttcagcttgcgctcgttttggcgaacacgtttttatgcgcgattttggaaatgtgttt
gccaaactccttcgtgaagattacagtcgtacctaa

DBGET integrated database retrieval system