KEGG   Schizosaccharomyces pombe (fission yeast): SPCC338.05cHelp
Entry
SPCC338.05c       CDS       T00076                                 

Gene name
mms2
Definition
(RefSeq) ubiquitin-conjugating enzyme Mms2
  KO
K10704  ubiquitin-conjugating enzyme E2 variant
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC338.05c (mms2)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic Type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    SPCC338.05c (mms2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UQ_con RWD
Motif
Other DBs
NCBI-GeneID: 2538720
NCBI-ProteinID: NP_588162
PomBase: SPCC338.05c
UniProt: O74983
Position
III:join(1366621..1366631,1366679..1366817,1366981..1367106,1367285..1367364,1367414..1367477)
Genome map
AA seq 139 aa AA seqDB search
MAKVPRNFKLLEELEKGEKGLGESSCSYGLTNADDITLSDWNATILGPAHSVHENRIYSL
KIHCDANYPDAPPIVTFVSRINLPGVDGETGKVNPHKIDCLRHWKREYSMETVLLDLKKE
MASSSNRKLPQPPEGSTFF
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagtccctcgcaattttaaattacttgaagagctagaaaagggcgaaaaaggc
ctcggagagagttcttgctcatatggtttgacgaacgccgatgatattacattgtccgac
tggaatgcaacgattttaggacctgcccatagcgttcatgaaaatcgcatttacagtttg
aagattcactgcgatgccaattaccctgatgctcctcccatcgtcacgttcgtatctaga
attaatttgcctggagttgatggtgaaacaggaaaagtaaatccccacaaaattgactgc
cttcgccattggaagagagaatactctatggaaactgttcttctagatttaaaaaaagaa
atggcatcctcttccaaccgaaaacttcctcagccccctgagggtagtacatttttttaa

DBGET integrated database retrieval system