KEGG   Schizosaccharomyces pombe (fission yeast): SPCC4B3.05c
Entry
SPCC4B3.05c       CDS       T00076                                 

Gene name
hem12
Definition
(RefSeq) putative uroporphyrinogen decarboxylase Hem12
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00860  Porphyrin and chlorophyll metabolism
spo01100  Metabolic pathways
spo01110  Biosynthesis of secondary metabolites
spo01240  Biosynthesis of cofactors
Module
spo_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPCC4B3.05c (hem12)
Enzymes [BR:spo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     SPCC4B3.05c (hem12)
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-GeneID: 2539032
NCBI-ProteinID: NP_588085
PomBase: SPCC4B3.05c
UniProt: Q9USJ5
Position
III:join(1166571..1166604,1166662..1166696,1166743..1166767,1166815..1167323,1167373..1167837)
AA seq 355 aa
MKNDLILRAAKGEEVERPPVWIMRQAGRYLPEYHKLRAKQSFFEMCQTPETACELTLQPV
TRFKGLLDAAIIFSDILVIPQALGMQVVMLEQKGPHFPKPLVVPEDIDLLEKTPNISAKL
GYVMDAISLTREKLDGQVPLMGFSGAPWTIMAYMIEGGGSKTFAKAKSWLFRYPEASHKL
LKIITDATVSYLIQQVYAGAQLLQIFDSWAGELSPEDFTEYAYPYLVRICQEVKQHLKKK
KRDEVPMIVFAKGAWYAIDQLCDSGYDVIGLDWTVSPKEAVRIRGNRRVTFQGNLDPNIL
YGTREIIEARTKEMIQDFGGGKQGYIINLGHGITPGVNPDDVRFFLEKCHQYGSA
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaaaaatgacttgattcttagggctgcaaagggagaagaagtagaacgtcctcctgtt
tggattatgaggcaagctggaagatatcttcctgaatatcataagcttcgtgctaaacaa
agcttttttgagatgtgtcaaacacctgaaacggcgtgtgagctaacacttcagccagtc
acccgctttaaaggtctgcttgacgcagcaattatttttagtgacattttagtgatccct
caagcattagggatgcaagtggttatgcttgagcaaaaagggccgcattttcctaaacct
ctggttgtgcctgaagatattgaccttttagaaaaaactcccaacatctcggctaaattg
ggatatgtaatggatgcaatttctttgactcgcgaaaaattagatggacaggtccctttg
atgggattttctggtgctccttggactattatggcctacatgattgaaggaggtggctcc
aaaacttttgcaaaagctaaatcttggctttttcggtaccccgaggcttcccacaagctt
cttaaaatcattaccgatgccacggtttcatatctgatacagcaagtatacgctggagca
cagctacttcaaatttttgattcctgggctggtgaattatcccccgaagactttacggag
tatgcatacccttatctggtgcgaatatgtcaagaagttaagcaacacttgaagaaaaag
aaacgagacgaggttcctatgattgtttttgcaaaaggtgcttggtatgcaattgaccaa
ttgtgtgattcaggttacgatgttattggtttagactggacggtcagtcccaaagaggct
gtccgtattcgaggtaatcgtcgtgttacattccaaggtaacttggatcctaacatttta
tatggcacacgcgaaattattgaagcccgtaccaaggaaatgatccaagattttggaggc
ggaaaacaaggctatattattaatttgggtcatggtattacacctggtgtcaatccagat
gatgttcgcttcttcttagagaaatgtcatcaatatggctctgcgtaa

DBGET integrated database retrieval system