KEGG   Schizosaccharomyces pombe (fission yeast): SPCC4B3.15Help
Entry
SPCC4B3.15        CDS       T00076                                 

Gene name
mid1
Definition
(RefSeq) medial ring protein Mid1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PH
Motif
Other DBs
NCBI-GeneID: 2539205
NCBI-ProteinID: NP_588075
PomBase: SPCC4B3.15
UniProt: P78953
Structure
PDB: 

Position
III:complement(1147453..1150215)
Genome map
AA seq 920 aa AA seqDB search
MKEQEFSYREAKDVSLDSKGLENSFLSSPNREKTPLFFEGNSNETSGYDQTKNFTHGDGD
MSLGNLSELNVATDLLESLDLRSMYMHGYGHLDSSFSSQHSPDNRKRMSSTSVFKRINSE
EEGRIPSLTYSAGTMNSTSSSTASLKGADIVADYETFNPDQNLAELSFDRSKSSRKRAVE
VAEFSRAKTMSPLEYTVQHPYQSHNELSTNPARARAGSVPNLARIPSDVKPVPPAHLSAS
STVGPRILPSLPKDTTEDNPALERVETTASLDMDYKPLEPLAPIQEAPVEDTSEPFSSVP
EATLDDSDISTESLRKKVLAKMEAKRISSGSSYASTLRKVYDFSELSLPTNGKDYDELYL
QSSRNSEPEISTIINDSLQQENMDEDISATSIPKSQAAYGHGSVTYHEVPRYNLTSASVG
YSISSQRGRIKSSSTIDNLSAILSSEDLRHPSMQPVPGTKRTYSNYCENEPNKSSQSLVS
SESHNVEGWNYSETGTVGFYDPSAEISASIDELRQSTPVARDSELLSRAHSFDLNRLDLP
SQDKSTSYEVPNGTENQSPRPVTSLGFVNETFFEEKPKAPLPLGRFYIHLNSILNISISE
VHSPIKIIVNTPTQNMQLPWQAVNGNNRLDHDFAFHVDDNFKVSFMFLDIPIEDKSNGSK
GVSATKDVSNGKPAETKSKARKFFDKLFNRRKKRKLNKAAAVENSKAKKSVVIKKVSGTA
TLNLGNVKDSCFGKAFNVEIPIISRGFLEAIPVKINSIGKRTLGNLTLTCLYIPELSVPE
QELPFTLEQATMDLRHVRSNYLYNEGYLYRLEDSSIRRRFVVLRSKQLNFYAEKGGQYLD
TFQLSKTVVSIPMVNFSEAVSNLGLVAGILATSVDRRHVQLFADSKKVCQKWLQVMNSRS
FALDRGTEKLWLQEYVNFMA
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcaagagttctcatatagagaagcaaaagatgtgtctcttgactctaaaggc
ttagaaaacagttttctttcttctccaaatcgagaaaaaacaccccttttttttgagggt
aacagtaatgaaacctcgggatatgatcaaacaaaaaactttacacatggagatggcgat
atgtcccttggaaacctttcggaactaaacgttgcgacagatcttttagagtcacttgat
ttaagaagcatgtatatgcatggctatgggcacctcgattcatctttttcttctcaacat
agtcctgataatcgtaaaagaatgagtagtacatcagtgtttaagaggattaattccgag
gaagaaggtcgcattcctagtttgacgtactcggcaggaactatgaactcgacaagttct
tctactgcgtctttgaaaggtgctgatattgttgcagattatgaaacatttaatccggat
caaaatttagctgaattatcctttgaccgctccaaatcgtctcgcaagagggcggtagaa
gtagcagaatttagtcgagctaagacaatgtctccgttggaatacactgttcaacatcca
tatcaatcccataatgaactgtctacaaacccagcccgagcaagagctggaagcgttccc
aacttggctcgcataccatctgatgtcaagcccgtacctccagcacatctatctgcatct
tctactgtaggtccaaggattcttcctagtcttcccaaagataccacagaggacaatcca
gcgttggaaagggtcgaaacgacggcgtctctcgatatggattataaacctttagaacct
ttagctcccattcaggaagcccctgttgaagatacttcagagcctttttcttcagtccca
gaggccaccttagacgactcagatatctctacagaaagtcttcgtaaaaaggttttggcc
aagatggaagcaaaacggatttccagtggatcttcctatgctagtacacttaggaaagtt
tatgatttctctgagctttcccttcccaccaacggtaaagactatgatgagttatacctt
caatcttcccgtaattcagaacctgagatttctactattatcaatgattctttacaacag
gaaaatatggatgaggatattagtgccacttcaattccgaaatctcaggccgcctatggt
catggatctgtaacgtatcatgaagtccccagatacaatctaacttctgcttccgtggga
tatagtatatctagtcaacgtggtcgtataaaaagcagttctaccattgacaatttgagt
gctattttaagctctgaagatttacgtcacccatcaatgcaacccgtaccaggaacgaag
cgtacttatagtaattattgtgaaaatgagccaaacaagtctagccaaagtttagtcagt
tctgagtcccataacgtcgaaggatggaattattcggaaactggtacagtaggtttttac
gaccctagtgccgagatatccgccagcattgatgaacttaggcagtctacgcctgtagcc
agagatagcgaacttttaagtcgtgcacattcctttgatttgaatcgccttgatcttcca
agtcaggataagagtacgtcttacgaagtcccgaatggtactgaaaatcaatcaccacgt
cctgttacttctcttggatttgtgaatgaaacattttttgaagagaaaccaaaggcgccc
ttgccacttggtcgcttttatatacatttgaacagcattttgaatatttcgataagtgaa
gtccattcacctatcaagataatagttaatacgcctacgcaaaatatgcagcttccttgg
caagctgttaatgggaataataggttggaccatgattttgcttttcatgttgacgataac
tttaaagtgagttttatgtttcttgacatccctattgaggacaagtccaacggttcgaaa
ggagtatctgctacaaaagacgtttcaaacggtaagcctgctgaaacgaaatccaaagct
aggaaattttttgacaagcttttcaaccgacgcaaaaagagaaaactcaacaaggctgct
gcagttgagaattcaaaggctaagaagtcagtggttatcaagaaagtctcgggtactgct
acgttaaatttgggtaatgtcaaagacagttgttttggaaaggctttcaacgtagaaata
cccatcatttccagaggcttcttggaagcgattcctgtaaaaataaactctatagggaaa
cgtacacttggtaatctaactttgacttgtttgtatattcctgagctttcggttccagag
caggaattgccatttaccttagaacaagctacgatggacttgcgacacgttagaagtaac
tatctatataatgagggatacttgtatagattggaagattcatctattcgaagacgtttt
gtcgttttacgctcaaagcagctgaatttttatgctgaaaaaggtgggcaatatttggat
acttttcagctttctaagacagtagtttcaatcccaatggtaaatttttcagaggcagtt
tcaaacctcggtctagtagctggaatattggctacatctgttgatagaaggcatgttcag
ttgtttgcggactctaaaaaggtttgccaaaaatggcttcaggtgatgaattcacgctcg
tttgctctagataggggtactgagaaattatggttacaagaatacgtgaattttatggct
taa

DBGET integrated database retrieval system