KEGG   Schizosaccharomyces pombe (fission yeast): SPCC4E9.02
Entry
SPCC4E9.02        CDS       T00076                                 

Gene name
cig1
Definition
(RefSeq) cyclin Cig1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C MerR_2
Other DBs
NCBI-GeneID: 2539433
NCBI-ProteinID: NP_588110
PomBase: SPCC4E9.02
UniProt: P24865
Position
III:1227545..1228792
AA seq 415 aa
MDVSTQTRHATYFQDENQLQKDHIYVKKKSHIKLNTGVRAPFKAVDNINQQDEPTLIEGN
NESSISSSTGDTFEEDFAYQDKVEIEERSIRSTPKSIGDDDLENREGSFDAPEGILTHGK
HRLPTIPEWTKEDLAALSEAAARLQANPSPEDIETDPSMVPDYDPEIFHYMQSLERKLAP
PPNYMSVQQEIDWVTRHMLVDWIVQVQIHFRLLPETLFLAVNLIDRFLSIKVVSLQKVQL
VGLSALLIACKYEEIHPPSIYNFAHVVQGIFTVDEIIRAERYMLMLLDFDISWPGPMSFL
RRISRADSYDHDIRMLAKYLQEVTLMDEIFIGAHISFIAATAYYLSMQMLGHLDWTPCHV
YYSGYTARQLKPCAIIIMECLVDAPNHHNAIYRKYSENRMKRVSAFAHNWVLSVI
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggacgtttcgactcaaacaagacacgcaacatattttcaagatgagaatcagctacaa
aaggatcacatttatgtgaagaagaaaagtcacatcaagttaaatacgggtgttcgtgca
cctttcaaggcagtagataacatcaatcaacaagatgaaccaacattgattgaagggaat
aatgaatcctccatctcttcgtccactggcgacacttttgaagaggattttgcataccag
gacaaagtcgagatagaggaacggtcaattcgctccactcctaagtctattggagatgat
gatttggaaaaccgtgagggcagctttgacgcacctgaaggaattcttacacacgggaag
catagactaccaacaattcccgagtggaccaaggaagatttagccgccctgtctgaagct
gctgctcgattacaagctaacccatcgcctgaggatatagaaactgatccatccatggta
ccagactatgatcctgagatatttcactacatgcaatctttggaaaggaagctggctcca
cctcctaattacatgtcagttcagcaagagattgactgggttacaagacatatgcttgtt
gattggattgtgcaagttcaaatacattttcgtttacttcctgagacattatttttggcg
gtaaaccttatcgaccggtttctttccataaaagtcgtatctttgcaaaaagtccagttg
gtaggtttatcagctttgctgattgcctgtaagtatgaagagatacaccctccaagcatc
tacaactttgcgcatgttgtccaagggatcttcaccgttgacgaaatcattagagccgag
cgctatatgctgatgcttttggattttgacattagttggccagggcccatgtcgtttttg
cgtcgtataagtcgagctgattcttacgatcacgacattcgcatgctcgccaaatatctt
caagaagtaaccttgatggatgaaatttttataggtgcccatattagcttcattgctgct
actgcctactacttgtctatgcagatgttgggtcatttggattggactccttgccatgta
tattatagtgggtacacggctcgtcaattgaaaccgtgtgccataatcattatggaatgt
ttggtcgatgcccctaaccatcacaatgccatttaccgaaagtactcggagaatagaatg
aagcgagttagcgcctttgctcacaactgggtactaagtgtgatttga

DBGET integrated database retrieval system