KEGG   Schizosaccharomyces pombe (fission yeast): SPCC4G3.02
Entry
SPCC4G3.02        CDS       T00076                                 

Gene name
aph1
Definition
(RefSeq) bis(5'-nucleosidyl)-tetraphosphatase
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo00230  Purine metabolism
spo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPCC4G3.02 (aph1)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     SPCC4G3.02 (aph1)
SSDB
Motif
Pfam: HIT DcpS_C GalP_UDP_tr_C CwfJ_C_1
Other DBs
NCBI-GeneID: 2539292
NCBI-ProteinID: NP_587836
PomBase: SPCC4G3.02
UniProt: P49776
Position
III:complement(join(468839..469135,469245..469331,469396..469497,469626..469688))
AA seq 182 aa
MPKQLYFSKFPVGSQVFYRTKLSAAFVNLKPILPGHVLVIPQRAVPRLKDLTPSELTDLF
TSVRKVQQVIEKVFSASASNIGIQDGVDAGQTVPHVHVHIIPRKKADFSENDLVYSELEK
NEGNLASLYLTGNERYAGDERPPTSMRQAIPKDEDRKPRTLEEMEKEAQWLKGYFSEEQE
KE
NT seq 549 nt   +upstreamnt  +downstreamnt
atgccaaaacagctatatttctccaagtttcctgttggaagtcaagttttttatcgtact
aagttatctgccgcgtttgtaaacctgaaaccaattttaccaggtcatgttttggtaatt
ccgcaacgggcggtccctagattgaaagatttgacaccttcagagttgacggatttgttt
acttctgttcgcaaagtgcaacaggtaatcgaaaaggtgttttcggcatctgcatcaaac
attggtattcaagatggtgtagacgctggtcaaacagttcctcatgtacatgttcacatt
atccctcgtaaaaaggcagatttttcagaaaacgatctagtctacagtgagttggaaaaa
aacgaaggaaatcttgcttccctttatcttacgggaaatgagcggtatgcaggagatgag
agaccgccaaccagtatgaggcaagctattcctaaggacgaggatcgtaagccaagaaca
cttgaggaaatggaaaaggaagctcagtggttgaaagggtacttttccgaagagcaagag
aaggaataa

DBGET integrated database retrieval system