KEGG   Schizosaccharomyces pombe (fission yeast): SPCC4G3.10c
Entry
SPCC4G3.10c       CDS       T00076                                 

Gene name
rhp42
Definition
(RefSeq) DNA repair protein Rhp42
  KO
K10838  xeroderma pigmentosum group C-complementing protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SPCC4G3.10c (rhp42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spo03400]
    SPCC4G3.10c (rhp42)
DNA repair and recombination proteins [BR:spo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      SPCC4G3.10c (rhp42)
SSDB
Motif
Pfam: Rad4 BHD_3 BHD_1 BHD_2 Transglut_core Neur_chan_memb
Other DBs
NCBI-GeneID: 2539465
NCBI-ProteinID: NP_587828
PomBase: SPCC4G3.10c
UniProt: P87235
Position
III:452369..454429
AA seq 686 aa
MPPKRKASKNSVRGRKRRTRTNNLPLNPEVKEETVVSSTHRQTRSQSKKPSLSSSAEPPS
ESLDDNISALNSLQRSASSSEKGSDEDNEKLGSSEDDEFDDDFDTWEQVDLSPNKQEDKK
DLHIVTQHITPQLTKESKKGSSSAMDKSIRLSIHIMHFTCLLYHGSVRNRWLMNSLLLDG
LRDLLVEKQPSVVEAWVCSSQTHEDLLKLLNGLRMWWNKSFKIESHGLRKLGYRTLKQGF
DIGFSPEIFHNFHEYQASLLSLKGSRDLAAQGFTALCRSLNLKARLIFSLQPLTFSTASY
DDWSPHILPEETSTSIDDDLRYPIFWTEIYDQSEKKWIAVDAVVLNGVYTNDMTWFEPKG
AYAESKHLRMGIVAAYDNDLYAKDVTLRYTDYQSSRLKKIRHVSFADKYFDFYKAIFGQL
AKRNKDAEDIYEEKELESKVPIREPKSFADFKNHPEFVLIRHLRREEALLPNAKPVKTAT
FGNGKKATSEEVYLRKDVVICKTPENYHKEGRVIKEGEQPRKMVKARAVTISRKREHEFR
VAETNEPVLQGLYSSDQTELYVPPPIKDGIIPKNGYGNMDCFVESMIPKGAAHLPYRGIA
KIAKKLNIDYADAVTGFEFRKHRAIPVTTGIIVPEESAQMVYEEFLECEKIRIEKQQMKE
RKIIYGQWKHLLNALRIRKRIEEQYA
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgccacccaaacgcaaagcatccaagaactctgttcgcggaaggaaacgtaggacacgg
accaataacttacctcttaatcctgaagtgaaagaggaaactgttgtatcttcaactcac
cgtcaaactcgtagccagtcgaaaaagccaagtttgtcttcctcagcggaacctccttct
gagagtttagatgacaatatatcagcgttaaactcacttcaaaggagcgcatcttcatcc
gaaaaaggttccgatgaagacaatgagaagttaggcagctcagaagatgacgagtttgac
gacgattttgacacttgggaacaagttgatctttctcctaataaacaagaagataaaaaa
gatttacacatagtcacacagcatatcactcctcaacttacaaaagaatcgaagaaaggc
tcttctagtgcaatggataaaagcattcgattatctattcacattatgcactttacttgc
ttgttgtaccatgggtcagtaaggaatcgctggttaatgaattccttacttcttgatggg
ctgcgcgatttgcttgtcgaaaagcaaccgtccgtagtggaggcgtgggtttgtagtagc
cagacgcacgaggatttgttaaaattgttaaatgggcttcggatgtggtggaataaatct
tttaaaattgagagtcatgggcttcggaagttggggtatcgtactttgaaacaaggattt
gatatcggcttttcgccagaaatatttcataactttcatgaataccaagcatccttactt
tcgctaaaaggaagccgggatttggcggcacagggatttactgctctctgtcgatctctg
aatctgaaagcaagacttatattttctcttcaacctttgacattttctactgcttcctat
gatgattggtctccacatatcctccctgaagaaactagtacatctatagatgacgacctc
cgctatcctattttttggacggaaatctatgatcaaagtgagaagaaatggattgcggta
gatgcggttgtcttgaatggggtatataccaacgatatgacttggtttgaacccaaagga
gcgtatgcagagtcaaaacatctacgaatgggtattgttgctgcatatgataacgattta
tacgcaaaagatgtaactttgaggtatacagattaccaatcaagtaggcttaagaaaatt
cgacacgtttcttttgcagataagtattttgatttttataaggctatttttgggcaacta
gcaaagcgcaataaagatgcagaggatatatatgaagagaaagaactggaaagtaaagtg
cccattcgcgaacctaaaagctttgcagattttaagaatcatcctgaatttgtattgatt
agacatcttagaagagaagaagcattgcttcctaacgccaagcctgtgaagacagcaacc
tttggtaacggtaagaaagctacctctgaggaagtgtatctccgaaaagatgtggtcata
tgcaaaacgcctgaaaattatcacaaagaaggacgagtaattaaggaaggagaacaacct
cgaaaaatggtgaaggcgagagccgtcacaattagcaggaagcgtgaacacgaatttcgg
gttgctgaaacaaatgaaccagtgcttcagggtctatattcttccgatcaaactgagcta
tatgttccgcctccaatcaaagatggtattattcctaagaacggttatggtaatatggat
tgttttgttgagagcatgatccccaagggcgcagcacatttgccatatcgaggaattgct
aaaattgccaagaaactcaacattgattatgcggatgcagttacagggtttgaatttcgt
aaacatcgtgcgattccagttactacaggtataattgtacctgaagagtcggctcaaatg
gtttacgaagaatttcttgagtgtgaaaaaatcagaatagagaagcagcagatgaaagag
agaaaaattatttatgggcagtggaaacacttgctaaatgcacttcgtattcgaaagcgt
attgaagaacaatatgcttaa

DBGET integrated database retrieval system