KEGG   Schizosaccharomyces pombe (fission yeast): SPCC550.06c
Entry
SPCC550.06c       CDS       T00076                                 

Gene name
hsp10
Definition
(RefSeq) putative protein Hsp10
  KO
K04078  chaperonin GroES
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spo03110]
    SPCC550.06c (hsp10)
   03029 Mitochondrial biogenesis [BR:spo03029]
    SPCC550.06c (hsp10)
Chaperones and folding catalysts [BR:spo03110]
 Heat shock proteins
  HSP10
   SPCC550.06c (hsp10)
Mitochondrial biogenesis [BR:spo03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    SPCC550.06c (hsp10)
SSDB
Motif
Pfam: Cpn10
Other DBs
NCBI-GeneID: 2539489
NCBI-ProteinID: NP_588098
PomBase: SPCC550.06c
UniProt: O59804
Position
III:complement(1195418..1195732)
AA seq 104 aa
MATKLKSAKSIVPLLDRILVQRIKADTKTASGIFLPEKSVEKLSEGRVISVGKGGYNKEG
KLAQPSVAVGDRVLLPAYGGSNIKVGEEEYSLYRDHELLAIIKE
NT seq 315 nt   +upstreamnt  +downstreamnt
atggctaccaaactgaaatccgccaagtcaatcgtgcctcttttggatcgtattctggtt
caacgtatcaaggccgacaccaaaaccgcttctggtatctttctacctgagaagagcgtt
gaaaagttatccgaaggtcgtgttatttccgtcggaaagggcggttataacaaggaaggt
aaactggctcaacccagcgtagccgttggtgatcgtgtcttgctgcctgcttatggtgga
agcaacatcaaggtgggcgaagaggagtattcgttgtaccgtgatcacgagttgttggct
atcatcaaggaataa

DBGET integrated database retrieval system