KEGG   Schizosaccharomyces pombe (fission yeast): SPCC553.01cHelp
Entry
SPCC553.01c       CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2439
Motif
Other DBs
NCBI-GeneID: 2538994
NCBI-ProteinID: NP_587772
PomBase: SPCC553.01c
UniProt: O74939
Position
III:310539..312686
Genome map
AA seq 715 aa AA seqDB search
MDTSSNVFHYQVLWTSDKAKKVKVWKDGTMRFHSFNNRGILYDSDNRVVDDFFLNNKRIV
LDSEIEFNRTIVYVENLQTTTEANIPPIPRKSKLSETGKRPAYLLKPFQPPFHSANSDVS
NNSNGALSSNMLKTHAHHTNSTKSTIFRNANLQSYGVDDSDIGSLRCSSKHQLSVTPEIQ
PKAKFRPNSYLASSVEESNRANNTSPYPPSNSSVTALPKPSKIAYIPVLSKPKSFNGTLV
EDPVEEFGEDDIASDFFSSPSADLEADDFTTLNNSNAGHLLQNLSNDNVSVSVKALENGN
EEVSNNHARSPHSSRACNTIPSNKNDGLNDDHQRQDSSVAEPSPTSKRLRLTRLPLPLLR
KPTGKRQNFINITVTDPSKNLYERSVKTAAELASLQNVTETTDNEIPNSPDFLDAASEED
EHIPSLDSSSLLTPLALPNKKAFQPVKFRVPSFSSPLVKPASSSSFGRSHSHLGTSLRSN
ELNGSSASSSIFLQSNNAVNPNVSPSTVLEHAKHPSLAKHSGVSLRTGLLIYPKYANGSK
RKDGFGATSIISSGEHSSLPKNSKSRNVSVFSSPFNVPSFTVSSSDQVQKKKGNVPNAIE
TDSSPSDTISSSPTVRAVNLSPSKNQKPPKILTKIPDIFSKAGKKSPILPTFQESCSLPI
EPFSSNITDLPFVNTVTLASTSSKIKRAKLKMLKFKHAMTTQGRDLDSDEDGDFI
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatacaagttccaatgtttttcattatcaagtattgtggacgtctgataaagcaaaa
aaagtaaaagtttggaaagatgggacaatgcgcttccacagcttcaataatcgtggaatt
ctctacgattctgataaccgagtcgtagatgattttttccttaacaacaagagaattgtt
ctggattctgaaattgaatttaatagaactattgtttacgttgagaatttacaaacaact
actgaagcgaatattccacctataccgaggaaatcaaaattgagtgagacagggaagagg
ccagcttatttattaaaaccattccagcctccatttcactccgctaactcagatgtatct
aacaattcaaatggtgctttatcgtcaaatatgttaaaaacacacgctcatcatacaaat
tcaacaaaatccacgatcttccggaacgcaaatttgcaatcttatggagtagatgactca
gatattggtagtttgagatgttcaagtaagcatcaactgtcagtaacaccggaaatacaa
cccaaagctaagtttagaccaaactcatatctagcttcttctgttgaggaatctaatcga
gctaacaatacctctccctatcccccatctaactcatccgtaactgcgctaccgaaacct
tcgaaaattgcatatatccctgttttgtcaaaacccaagtcttttaatggcaccttggtt
gaagatcctgtagaagaatttggagaagacgacatagcttctgactttttttcttcccct
tctgccgatctcgaggcagatgattttaccactctaaataattcaaatgctggtcatttg
ttacaaaacctaagtaatgataacgtaagtgtctccgtgaaggcattagaaaatggaaat
gaagaagtttctaataatcatgctcgatctcctcattcttcccgcgcttgtaataccata
ccttccaacaaaaacgatgggctaaatgatgatcatcaaagacaagattcttctgttgca
gaacccagtcctacttctaaacgtctccgtttgactcgccttccgttacctctgcttcgg
aaacccacggggaaacgacaaaactttattaatatcacagttaccgacccctcaaaaaac
ttgtacgaaagaagtgtcaaaactgctgccgagctggcatcgcttcaaaatgtaacagaa
acaactgataatgaaataccaaactctcctgattttctagatgcagcatcagaagaggat
gaacacattccttcgctagattcgtcatctcttttaacacctttggctttgcccaacaaa
aaagcctttcaacccgtgaagtttcgtgtaccgtctttttcatctcctttagttaaacca
gcatcttcgtcctcgtttggtaggagtcactctcacttaggcacgtcccttcgctcaaac
gaacttaatggatctagtgcttcttcttcaatctttctacaatccaacaatgcagtcaat
cctaacgtttcaccttctactgtgcttgaacatgccaaacatccttccttggccaaacat
tcaggtgtatcgctgagaacaggcttgttgatatatcctaaatatgcaaatggttcgaaa
agaaaagacggttttggagctacttctataatatcttcaggggaacattcgtcgttgcct
aaaaactcgaaatccagaaatgtgtcggtattttctagcccttttaatgtcccttcgttt
actgtttcttcttcggaccaagtccaaaagaaaaaaggaaatgttcctaatgctattgaa
acggactcttctccttcggataccatttcatcctcgcctactgttcgagctgtaaatctc
tcacccagcaaaaaccaaaagcctccgaaaatacttaccaaaattccggatattttttct
aaagcgggaaagaaatctcctattttaccaacttttcaagagtcttgttcgttacctatt
gagcctttttcgtcaaacattacggatttgccatttgtaaatacagtaacacttgcttca
acgagtagcaagatcaaaagggcaaagttaaaaatgctaaaatttaagcatgccatgact
acacaaggacgcgatctcgattcggacgaagatggtgactttatttga

DBGET integrated database retrieval system