KEGG   Schizosaccharomyces pombe (fission yeast): SPCC553.10
Entry
SPCC553.10        CDS       T00076                                 

Definition
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: GPI-anchored
Other DBs
NCBI-GeneID: 2539384
NCBI-ProteinID: NP_587764
PomBase: SPCC553.10
UniProt: O74947
Position
III:complement(283422..284471)
AA seq 349 aa
MLFKISFLALIASALAMSINSPTNGDTWQTNGEEQITWNVVSTDEPSAALYLTNFAVYPT
VTQYLDTVDTSTGSYTTNTTNWPTGQGFQINMAYPGRPEQIYAQSQQFNIVEGAASSSSS
SSSSSSSLVSSTTSSSSSATPSTTSSSSSSSSSSSSSSSKSSSSSSKSSSRSSSRTTSHR
TTSHKSSSYRPTVFPYTTISHYNITNATNGTYCNGTNGTNFTCIVNASNATNSTFWLNGT
NSTNGTNSTNSTSTTSHSLTKLPTSSKSLTTSKTTASGHITKGVMEALSTNDTTNTTDDA
TNTTSDSSSSSSASASSSSSSSSAASLVSQPVGISAVIAFFAVALSLTL
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgttgttcaaaatttcctttttggctttgattgcttctgctctcgctatgtcgattaac
tctcccaccaatggtgacacttggcaaaccaacggcgaggagcaaatcacctggaatgtc
gtttccactgatgaacccagtgctgctctttacttgaccaactttgctgtttatcccacc
gttacccaatacttggacactgttgacaccagcactggttcttacaccaccaacaccacc
aactggcccactggtcaaggtttccaaatcaacatggcttaccctggtcgtcctgagcaa
atttatgctcaatctcaacaatttaacattgttgagggtgctgcttcttcttcttcctct
tcctcttcttcctccagctctttggtttcctccacaacctcttcttccagctctgccact
ccttcgaccacttcttcctcctcctcctcttcttcttcctcttcctcatcctcatctaaa
tcttcatcctcttcttccaagtcttcctctcgtagctcttctcgtactacttctcaccgc
actacttcccataagtcctcctcttatcgccctactgtattcccttacaccaccatctct
cactacaacattaccaatgctaccaatggtacatattgcaatggtactaacggtactaac
ttcacttgcatcgtcaatgcttctaatgccaccaactctactttctggttgaatggtacc
aactctaccaacggtaccaactctaccaactccaccagtaccacttctcacagtttgacc
aagctccctactagcagcaagagtttgactacttctaagaccactgctagcggacatatc
acaaaaggtgtaatggaggcccttagcaccaatgacactaccaacaccactgatgacgct
accaacaccacctctgactccagctcttctagctcagccagtgcctctagctcttccagc
tcatcatctgctgcctctttagtcagccaacctgttggtatttctgctgtgattgcattc
tttgctgtcgctctctctctcactctttaa

DBGET integrated database retrieval system