KEGG   Schizosaccharomyces pombe (fission yeast): SPCC569.06
Entry
SPCC569.06        CDS       T00076                                 

Name
(RefSeq) uncharacterized protein
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Other DBs
NCBI-GeneID: 2538696
NCBI-ProteinID: NP_588567
PomBase: SPCC569.06
UniProt: Q9Y7S5
Position
III:complement(2420664..2422100)
AA seq 478 aa
MKLFPLCLSALVMSTATCASSVEGAIEKVPQSLEQKGPSEMLSMKPDVKGGFGDRMMFIP
FQSDLGLHSPVDRSGFEYCGYLDAIESEDGDSSRAPYAKLQLKENVEGIARFGLFYHPSP
FQAFKHIIDNGGKYSGLDRVFLENLRKSLVVSLDSAVNRTYSIPVEDEGFYCFVGYQEVA
HQETVIGENSEPIVTIEFDSFNSNVPVTLKLQRQIFLSFSIVYGLISLWWAIRCICSRTK
LHLVQVCLFCWFSFFILNHPVKQRIFSIDNPDEYLVPFVVSCFTYFLGDGIEYALYSLFI
TTTVLGFGTIRRTSKKMVLFFSLLTCGQAFLVNVAPMVYPLLYISGSDKACVLRMVWVFN
KFLYLPLITFLGAVLAFRFRLKKASQFDTRWNLFALTLAIIILFAFNDLVIFDKLQKLWK
YDDTTLEYLKIVNGGIKFVAFSILLGPYSKLFAEPKSLQLDDFLGKHDGHKDPSLEKF
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgaaactcttcccattatgccttagtgctctcgttatgtcaaccgctacttgtgcctct
tcagtagagggggcgattgagaaagttcctcagtcattagaacaaaaaggtccttctgag
atgctgtcgatgaagccggatgtgaaaggtggtttcggagatcggatgatgtttatccct
tttcaaagtgacttaggcttacattcccctgtagatcgaagtggttttgaatattgtggt
tatcttgatgcaatagaaagcgaggacggtgatagctcaagagcaccttacgctaaactt
caattaaaggagaatgttgaaggaatagctcgatttggtttgttttatcatccatctccc
tttcaagcatttaaacatattattgacaatggtggaaagtatagtggattggatagagtg
tttttggagaatctgagaaagagtctagttgtttctcttgattcggcagttaaccgtact
tattcaatacctgtggaagatgaaggattttactgttttgttggatatcaagaagtcgct
catcaggaaactgtcattggtgagaactccgaacctattgtaacaattgagtttgattct
tttaattctaatgtacccgtgacgttaaaacttcaacgacaaattttcttatcattttct
atcgtatatggcttaatctcattatggtgggctattcgctgtatttgtagtcgcaccaaa
ttacatcttgttcaagtttgcttgttttgttggttttccttttttattttaaatcaccct
gtaaagcaacgaattttcagcattgataacccagatgagtacttagttccttttgttgtt
tcttgttttacatatttccttggtgatggtatcgaatatgcgctatatagcctatttatt
accaccactgtccttggatttggcacaattcgtcgaacatccaaaaaaatggttttgttt
ttttccttattgacatgtggacaagctttcttagtcaatgtggctccaatggtatatcca
cttctttacatttctggcagtgataaggcttgtgtgttgcgaatggtttgggtttttaat
aaattcttgtatttgcctctaattacctttcttggggcagttctagcattccgtttccgt
ttgaaaaaggcctcccaatttgatacccgttggaatttgtttgccttgactttggctatc
atcattctttttgcatttaatgatttagtgattttcgacaaattgcaaaaactttggaaa
tacgatgatactactcttgagtaccttaaaatagtaaatggtggtattaagtttgtggct
ttttccatccttttaggtccttatagcaaactgtttgcagagcctaaatccttacaatta
gacgattttttaggaaagcatgatggccataaggaccctagtctagaaaagttttaa

DBGET integrated database retrieval system