KEGG   Schizosaccharomyces pombe (fission yeast): SPCC576.03c
Entry
SPCC576.03c       CDS       T00076                                 

Gene name
tpx1
Definition
(RefSeq) thioredoxin peroxidase Tpx1
  KO
K03386  peroxiredoxin 2/4 [EC:1.11.1.24]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spo04147]
    SPCC576.03c (tpx1)
Enzymes [BR:spo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     SPCC576.03c (tpx1)
Exosome [BR:spo04147]
 Exosomal proteins
  Proteins found in most exosomes
   SPCC576.03c (tpx1)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-GeneID: 2539572
NCBI-ProteinID: NP_588430
PomBase: SPCC576.03c
UniProt: O74887
Position
III:complement(2085036..2085614)
AA seq 192 aa
MSLQIGKPAPDFKGTAVVNGAFEEIKLADYKGKWVFLGFYPLDFTFVCPTEIVAFSEAAS
KFAERNAQVILTSTDSEYSHLAFINTPRKEGGLGGINIPLLADPSHKVSRDYGVLIEDAG
VAFRGLFLIDPKGVLRQITINDLPVGRSVDEALRLLDAFQFVEEHGEVCPANWHKGSDTI
DTKNPEKYFSKH
NT seq 579 nt   +upstreamnt  +downstreamnt
atgagtttgcaaatcggtaaacctgctcccgacttcaagggtactgccgttgttaacggt
gctttcgaggaaatcaagttggccgattacaagggtaaatgggtcttcttgggcttctat
ccccttgactttacctttgtttgtcccactgagattgttgctttctctgaggccgcctcc
aagtttgctgaacgtaatgctcaagtcatcttgacctccaccgattccgagtactctcac
cttgccttcatcaacactcctcgtaaggaaggtggccttggtggcattaacattcccctt
ttggccgaccctagccataaggtttcccgtgactatggtgtcttgatcgaggatgccggt
gttgctttccgtggtcttttcttgatcgaccccaagggtgttttgcgtcaaatcaccatc
aatgatctccccgttggccgttctgtcgacgaggctctccgtcttctcgatgccttccaa
ttcgttgaggagcacggtgaggtttgccctgccaactggcacaagggttccgataccatt
gacaccaaaaaccccgagaagtacttttccaagcactag

DBGET integrated database retrieval system