KEGG   Schizosaccharomyces pombe (fission yeast): SPCC61.01c
Entry
SPCC61.01c        CDS       T00076                                 
Symbol
str2
Name
(RefSeq) siderophore-Fe(3+) transporter Str2
Organism
spo  Schizosaccharomyces pombe (fission yeast)
SSDB
Motif
Pfam: MFS_1 OATP
Other DBs
NCBI-GeneID: 2539559
NCBI-ProteinID: NP_588192
PomBase: SPCC61.01c
Ensembl: SPCC61.01c
UniProt: O94607
Position
III:complement(1435212..1442233)
AA seq 597 aa
MTENYGSMEHRKKSFRNNENLEQQFHPLREELDNAGPINDRTSELSLEGVSKAEAIASTW
SKRSIIVAYLGLYLLSFASSLEQQTTYSLQRYATSNFSAHSNLATINLVGNILLAVVRAP
MVKAADVFGRSESLSLALGMTVLGYLSLAFSRNIQMFTVAYILYICGQTGLGLLSQLIIA
DTSSLLNRGILSAIPELPYLATVWIGPVLAQAFHPEKNYGWRLGYGIWAFILPTVSLPLL
ASLFLNQRKAKAAGLYREHHNLINHSTPEKLRLFYLFWQELDGLGIVLFVSGFTLLLLPF
SHSSQVVSPDSTILTLFTITLSIALLVTLCFYDVKYARYPVFALKSLKDRTILGSCVLIF
TYFMSYYIFSNFLTSFLQVSYGLSIDMSSLTLNVFVFSMTTTAILSGFLMKRFGRFKMLL
MISVPMYVLGILGIILFGINDNHYTRPLVLVLILAGMGGGLLTLSAQIAVQSVSSHAKLG
MNLTLYLTFSSVGGAFGSAIAGGVWSKRLSSRLLHDLKDHLPVPEIESIFRDLRTALSYP
QGTQIRNIINVAYTATEKDLFHISLVASLFMFAGLVIIRDVPLSTENHDTAVETPSE
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgactgagaattatggaagcatggagcatcgtaaaaagagttttcgtaataacgaaaat
ttagaacagcaatttcatccccttagagaagagcttgataatgctggacccataaatgat
cgtacttcagaattgtcactagaaggtgtttccaaagctgaggcaattgcttcaacatgg
tctaaaagatcgattattgttgcttaccttggtctctatttgttgtcatttgcatcttca
ttagagcagcaaactacgtattctttgcaaagatacgcaaccagcaacttttccgcccat
tcaaacttggctacaatcaatttggtgggcaatattcttttagcagttgttcgagcacca
atggtaaaggctgccgatgtctttggacgttcggagagtcttagtttagcattaggaatg
acagtgttgggatatctttcattggcattttctcgaaatattcaaatgtttaccgtagca
tatatcctctatatatgcggccaaactgggctaggtctgttatctcaattaattattgca
gacacatcttcgctactcaatcgggggattctctctgctatcccagaacttccctatctt
gcaactgtttggattggaccagtgcttgctcaagcctttcatcctgagaaaaattatggg
tggagattgggttatggtatatgggcgttcattttaccaacagtttcattacctctcttg
gcttcgcttttcctaaaccaaagaaaagccaaggctgcaggtttatatagagaacatcat
aacttgatcaatcattccactcctgaaaaacttagactattttatttgttttggcaggaa
ttggatggtcttggaatagtgttgtttgtgtctggctttacgcttttgttgctgcctttt
tcccattcgagtcaggtagtttcaccagactcaacaattttaactctctttactataact
ctctccattgctttgttagtaaccctatgcttctacgacgtcaaatatgcacgctatccc
gttttcgccttaaaatctttgaaagaccgtaccatccttggttcatgcgttttaattttc
acatatttcatgtcttattatattttctcaaattttttaacttctttccttcaagtctct
tatggattatcaattgacatgagtagccttacccttaatgtttttgtattttcaatgact
acgacggctatcctgtcaggttttctcatgaagcggtttggtcgcttcaagatgttgctt
atgatttctgttcctatgtacgtattggggattttgggtatcatcttatttggtattaac
gataaccactatacccgtcccctagttttagtgcttatacttgctggtatgggaggtggg
ttactgacgttaagtgcgcaaattgctgttcagtcagtatcgtcacatgctaaattaggt
atgaatctcacgttgtatttaacgttttcttctgttggtggtgcctttggatctgctatt
gcaggaggcgtatggagtaagaggctctcaagtcgtttgttacatgaccttaaagatcat
cttcctgtcccagaaattgaatcaatattccgggacctacgaactgctctgtcatacccc
caagggactcaaattcgtaatatcattaatgttgcttatactgccaccgagaaggatctt
ttccatatctcacttgttgcctctttatttatgtttgccggacttgttataattagagat
gtccccctttccactgaaaatcatgatacagccgtcgaaactccctcagaataa

DBGET integrated database retrieval system