KEGG   Schizosaccharomyces pombe (fission yeast): SPCC613.08
Entry
SPCC613.08        CDS       T00076                                 

Definition
(RefSeq) putative cyclin-dependent kinase regulator
  KO
K15262  protein BCP1
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Brite
KEGG Orthology (KO) [BR:spo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spo03009]
    SPCC613.08
Ribosome biogenesis [BR:spo03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   SPCC613.08
SSDB
Motif
Pfam: BCCIP
Other DBs
NCBI-GeneID: 2538703
NCBI-ProteinID: NP_587696
PomBase: SPCC613.08
UniProt: O74907
Position
III:join(93146..93230,93285..93496,93618..94169)
AA seq 282 aa
MAKRHAEENEDTVMSESLKVVDTDFINVDFEFFDPQPIDFHAFKNLLKQLLGYDHTNVNL
SALADLILSQPLLGSTVKVDGNNSDPYAMLSVINLNTRRDEPVIKQLTSYIISRLAKSNS
RLENELQKLLEPNSGSQVGLIVNERLINMPVQVIPPMYNMLLEEMQWAINENEPYNFTHY
LLLSRTYTEIESKLMDDERPSKKGKKSKKTSGEEVMFFHPEDEQFREVAIDIADYPFANQ
DFNPDANRVFQDAGIKPQGELLLMTNEDFKNLVPKLMEIYSA
NT seq 849 nt   +upstreamnt  +downstreamnt
atggcaaaaaggcacgcagaagagaatgaagatactgttatgtctgaaagcctgaaagta
gtagacacggactttattaatgtagattttgaattctttgaccctcaacccattgacttt
catgcctttaagaacttgttaaagcaattattaggttatgaccatacaaatgttaatctt
agtgctttggctgatttgatacttagtcagcctttgcttggttcaactgtaaaagttgat
ggtaacaattctgatccttatgcaatgctttctgttatcaatttgaatacaagaagggat
gagccagtgattaagcaattaacctcatacatcatttctcgactagccaaatcgaattcg
agactcgagaacgagttacagaaactactggaaccaaattctggctcccaagttggtctc
atagtgaatgaacgtctgataaacatgcctgtccaagtaatcccccctatgtataacatg
cttttagaggaaatgcaatgggccatcaatgaaaacgaaccctacaactttactcactat
ttgctgctttcacggacttatactgaaattgaatcaaagttaatggatgatgagcgtcct
tccaaaaaaggtaaaaagagtaaaaagacatctggtgaggaagttatgtttttccatccc
gaggatgaacagtttcgcgaagttgctattgatattgccgattatccctttgcaaaccag
gattttaatccggatgccaatcgagtatttcaagatgcaggaatcaagccccagggagag
ctgttgcttatgacaaatgaggatttcaaaaatttggttcccaagctgatggaaatttac
agcgcttga

DBGET integrated database retrieval system